Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G42980-AT3G59080
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Eukaryotic aspartyl protease family protein
Function (paralog2):Eukaryotic aspartyl protease family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.9663413761766
Log2 mRNA fold difference:-0.72175374674758
Log2 TE fold difference:-0.74214161673017
Sequences
Protein sequence

MSTKLSIFLLGLILFSVSPFSGDCRTLSGKHEHYSSSLNMFNSQDTMRFSSASSSTSNDC
GFSSKEHDPSKEHTRESVKPQSRIKQETKRTTHSVVDLQIQDLTRIKTLHARFNKSKKQK
NEKVRKKITSDISLVGAPEVSPGKLIATLESGMTLGSGEYFMDVLVGTPPKHFSLILDTG
SDLNWLQCLPCYDCFHQNGMFYDPKTSASFKNITCNDPRCSLISSPDPPVQCESDNQSCP
YFYWYGDRSNTTGDFAVETFTVNLTTTEGGSSEYKVGNMMFGCGHWNRGLFSGASGLLGL
GRGPLSFSSQLQSLYGHSFSYCLVDRNSNTNVSSKLIFGEDKDLLNHTNLNFTSFVNGKE
NSVETFYYIQIKSILVGGKALDIPEETWNISSDGDGGTIIDSGTTLSYFAEPAYEIIKNK
FAEKMKENYPIFRDFPVLDPCFNVSGIEENNIHLPELGIAFVDGTVWNFPAENSFIWLSE
DLVCLAILGTPKSTFSIIGNYQQQNFHILYDTKRSRLGFTPTKCADI

MFSKYSFILCLIFFFVTAFSGDSRALAGNNEQKNISGFSGIDFPNPMRFGSASSSTSNDC
GFSSPEKEPTKERTGENKTVKFHLKRRETTTTEKATTNSVLELQIRDLTRIQTLHKRVLE
KNNQNTVSQKQKKNDKEVVTTTPVASSVEEQAGQLVATLESGMTLGSGEYFMDVLVGSPP
KHFSLILDTGSDLNWIQCLPCYDCFQQNGAFYDPKASASYKNITCNDQRCNLVSSPDPPM
PCKSDNQSCPYYYWYGDSSNTTGDFAVETFTVNLTTNGGSSELYNVENMMFGCGHWNRGL
FHGAAGLLGLGRGPLSFSSQLQSLYGHSFSYCLVDRNSDTNVSSKLIFGEDKDLLSHPNL
NFTSFVAGKENLVDTFYYVQIKSILVAGEVLNIPEETWNISSDGAGGTIIDSGTTLSYFA
EPAYEFIKNKIAEKAKGKYPVYRDFPILDPCFNVSGIHNVQLPELGIAFADGAVWNFPTE
NSFIWLNEDLVCLAMLGTPKSAFSIIGNYQQQNFHILYDTKRSRLGYAPTKCADI

www.000webhost.com

Other information
Ka divergence:-0.348532KaKs divergence:0.999727
GC content 1 (%):43GC content 2 (%):44GC content divergence:0.011
Length 1 (bp):1584Length 2 (bp):1608Length divergence:0.008
MFE 1 (kcal):-446.21MFE 2 (kcal):-474.57MFE divergence0.031