Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G43020-AT3G59050
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):polyamine oxidase 2
Function (paralog2):polyamine oxidase 3

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:1.727224427224
Log2 mRNA fold difference:1.3145543979426
Log2 TE fold difference:0.26585567211386
Sequences
Protein sequence

MESRKNSDRQMRRANCFSAGERMKTRSPSVIVIGGGFGGISAARTLQDASFQVMVLESRD
RIGGRVHTDYSFGFPVDLGASWLHGVCKENPLAPVIGRLGLPLYRTSGDNSVLYDHDLES
YALFDMDGNQVPQELVTQIGVTFERILEEINKVRDEQDADISISQAFSIVFSRKPELRLE
GLAHNVLQWYVCRMEGWFAADAETISAKCWDQEELLPGGHGLMVRGYRPVINTLAKGLDI
RVGHRVTKIVRRYNGVKVTTENGQTFVADAAVIAVPLGVLKSGTIKFEPKLPEWKQEAIN
DLGVGIENKIILHFEKVFWPKVEFLGVVAETSYGCSYFLNLHKATGHPVLVYMPAGQLAK
DIEKMSDEAAANFAVLQLQRILPDALPPVQYLVSRWGSDVNSMGSYSYDIVGKPHDLYER
LRVPVDNLFFAGEATSSSFPGSVHGAYSTGLMAAEDCRMRVLERYGELDLFQPVMGEEGP
ASVPLLISRL

MESGGKTNRQLRKAICVSTDEKMKKKRSPSVIVIGGGMAGISAARTLQDASFQVVVLESR
DRIGGRVHTDYSFGFPVDLGASWLHGVCKENPLAAVIGRLGLPLYRTSGDNSVLYDHDLE
SYALFDKAGNQVSQELVTKVGENFEHILEEICKVRDEQDEDMSIAQAFSIVFKRNPELRL
EGLAHNVLQWYLCRMEGWFAADAETISAKCWDQEELLPGGHGLMVRGYRPVINTLSKGLD
IRLSHRITKISRRYSGVKVTTEKGDTFVADAAVIALPLGVLKSGMITFEPKLPQWKQEAI
NDLGVGIENKIILNFDNVFWPNVEFLGVVAETSYGCSYFLNLHKATSHPVLVYMPAGQLA
RDIEKKSDEAAANFAFSQLQKILPDASSPINYLVSRWGSDINSLGSYSYDIVNKPHDLYE
RLRVPLDNLFFAGEATSSSYPGSVHGAYSTGVLAAEDCRMRVLERYGELEHEMEEEAPAS
VPLLISRM

Other information
Ka divergence:0.161472KaKs divergence:0.0597101
GC content 1 (%):47GC content 2 (%):45GC content divergence:-0.022
Length 1 (bp):1473Length 2 (bp):1467Length divergence:-0.002
MFE 1 (kcal):-502.5MFE 2 (kcal):-485.9MFE divergence-0.017