Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G43050-AT3G59010
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Plant invertase/pectin methylesterase inhibitor superfamily
Function (paralog2):pectin methylesterase 61

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-2.7685979855948
Log2 mRNA fold difference:-3.1417094368224
Log2 TE fold difference:0.39213480534002
Sequences
Protein sequence

MASSSSISNHKIPNTLMFLVIVNFLYLIQTNSAVSISSNSNSHFSRFSRHRSSPSSKTKQ
GFLATVQESMNHALLARSLAFNLTLSHRTVQTHTFDPIHDCLELLDDTLDMLSRIHADND
EEDVHTWLSAALTNQDTCEQSLQEKSESYKHGLAMDFVARNLTGLLTSSLDLFVSVKSKH
RKLLSKQEYFPTFVPSSEQRRLLEAPVEELNVDAVVAPDGSGTHKTIGEALLSTSLASSG
GRTKIYLKAGTYHENINIPTKQKNVMLVGDGKGKTVIVGSRSNRGGWTTYKTATVAAMGE
GFIARDMTFVNNAGPKSEQAVALRVGADKSVVHRCSVEGYQDSLYTHSKRQFYRETDITG
TVDFIFGNSAVVFQSCNIAARKPLPGQRNFVTAQGRSNPGQNTGIAIQNCRITAESMTYL
GRPWKEYSRTVVMQSFIGGSIHPSGWSPWSGGFGLKSLFYGEYGNSGPGSSVSGRVKWSG
CHPSLTVTEAEKFTVASFIDGNIWLPSTGVSFDPGLVN

MATTSFSLPNHKFGIKLMLFLVLNLLSLQTSVFAHSSNSKFTKISRHPNSDSSSRTKPST
SSNKGFLSSVQLSLDHALFARSLAFNLTLSHRTSQTLMLDPVNDCLELLDDTLDMLYRIV
VIKRKDHVNDDVHTWLSAALTNQETCKQSLSEKSSFNKEGIAIDSFARNLTGLLTNSLDM
FVSDKQKSSSSSNLTGGRKLLSDHDFPTWVSSSDRKLLEASVEELRPHAVVAADGSGTHM
SVAEALASLEKGSGRSVIHLTAGTYKENLNIPSKQKNVMLVGDGKGKTVIVGSRSNRGGW
NTYQSATVAAMGDGFIARDITFVNSAGPNSEQAVALRVGSDRSVVYRCSIDGYQDSLYTL
SKRQFYRETDITGTVDFIFGNSAVVFQSCNLVSRKGSSDQNYVTAQGRSDPNQNTGISIH
NCRITGSTKTYLGRPWKQYSRTVVMQSFIDGSIHPSGWSPWSSNFALKTLYYGEFGNSGP
GSSVSGRVSWAGYHPALTLTEAQGFTVSGFIDGNSWLPSTGVVFDSGLL

www.000webhost.com

Other information
Ka divergence:-0.0490455KaKs divergence:-0.416699
GC content 1 (%):48GC content 2 (%):47GC content divergence:-0.011
Length 1 (bp):1557Length 2 (bp):1590Length divergence:0.01
MFE 1 (kcal):-543.35MFE 2 (kcal):-503.27MFE divergence-0.038