Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G43090-AT2G43100
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Aconitase/3-isopropylmalate dehydratase protein
Function (paralog2):isopropylmalate isomerase 2

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-1.5165815828874
Log2 mRNA fold difference:-1.574720221268
Log2 TE fold difference:0.038199025398399
Sequences
Protein sequence

MAASLQSANPTLSRTLASPNKPSSFATFRSPFLRFNSTSVASNFKPLVSREASSSFVTRS
AAEPQERKTFHGLCYVVGDNIDTDQIIPAEFLTLVPSNPEEYEKLGSYALVGLPASYKER
FVQPGEMKTKYSIIIGGENFGCGSSREHAPVCLGAAGAKAVVAQSYARIFFRNSVATGEV
YPLDSEVRVCDECTTGDVATVELREGDSILINHTTGKEYKLKPIGDAGPVIDAGGIFAYA
RKAGMIPSAAA

MAYSLPTFPQALPCSSTKTSSSLATFRSPFLRFNGSTSLIPSSISITSRGTSSPTIIPRA
AASESDSNEALANTTFHGLCYVLKDNIDTDQIIPAGAACTFPSNQQERDEIAAHALSGLP
DFHKTRFIEPGENRSKYSIIIGGENFGCGSSREHAPVCLGAAGAKAIVAESYARIFFRNS
VATGEVFPLESEVRVCEECKTGDTVTIELSDSGGLLTNHTTGKNYKLKSIGDAGPVIDAG
GIFAYARMMGMIPSLA

www.000webhost.com

Other information
Ka divergence:0.367725KaKs divergence:0.99986
GC content 1 (%):47GC content 2 (%):49GC content divergence:0.021
Length 1 (bp):756Length 2 (bp):771Length divergence:0.01
MFE 1 (kcal):-228.3MFE 2 (kcal):-231.57MFE divergence0.007