Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G43090-AT3G58990
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Aconitase/3-isopropylmalate dehydratase protein
Function (paralog2):isopropylmalate isomerase 1

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.0113523462141
Log2 mRNA fold difference:-1.5022763704385
Log2 TE fold difference:0.57366117465662
Sequences
Protein sequence

MAASLQSANPTLSRTLASPNKPSSFATFRSPFLRFNSTSVASNFKPLVSREASSSFVTRS
AAEPQERKTFHGLCYVVGDNIDTDQIIPAEFLTLVPSNPEEYEKLGSYALVGLPASYKER
FVQPGEMKTKYSIIIGGENFGCGSSREHAPVCLGAAGAKAVVAQSYARIFFRNSVATGEV
YPLDSEVRVCDECTTGDVATVELREGDSILINHTTGKEYKLKPIGDAGPVIDAGGIFAYA
RKAGMIPSAAA

MATSQQFLNPTLFKSLASSNKNSCTLCPSPFLQLKSASTIFNYKPLTSSSATIITRVAAS
SSDSGESITRETFHGLCFVLKDNIDTDQIIPAEYGTLIPSIPEDREKLGSFALNGLPKFY
NERFVVPGEMKSKYSVIIGGDNFGCGSSREHAPVCLGAAGAKAVVAESYARIFFRNCVAT
GEIFPLESEVRICDECKTGDVVTIEHKEDGSSLLINHTTRKEYKLKPLGDAGPVIDAGGI
FAYARKAGMIPSA

www.000webhost.com

Other information
Ka divergence:0.202713KaKs divergence:-0.0150862
GC content 1 (%):47GC content 2 (%):49GC content divergence:0.021
Length 1 (bp):756Length 2 (bp):762Length divergence:0.004
MFE 1 (kcal):-228.3MFE 2 (kcal):-221.44MFE divergence-0.015