Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G43160-AT3G59290
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):ENTH/VHS family protein
Function (paralog2):ENTH/VHS family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-2.5022570768986
Log2 mRNA fold difference:-1.8161401852659
Log2 TE fold difference:-0.60983832185435
Sequences
Protein sequence

MKKVFGQTVRDLKREVNKKVLKVPGVEQKVLDATSNEPWGPHGSLLADLAQASRNYHEYQ
LIMVVIWKRLSDTGKNWRHVYKALTVLEYMVGHGSERVIDEIRERAYQISTLSDFQYIDS
GGRDQGSNVRKKSQSLVALVNDKERIAEVRQKAAANRDKYRSSAPGGMYKPSGGYGDKYD
YGSRDEERSSYGREREYGYRDDDRNSRDGDRHSRDSEDRYGRDGNRDDDYRGRSRSVDNY
GSRGRSSEREREDDGHSSSRGSGARADDNSQDGRGGLQRKFSEQNIGAPPSYEEAVSDSR
SPVYSERDGGETPQVTAPGAASPPPPQVAAPEAASPPTGTNTANTTATFVNESPSQKVET
FDEFDPRSAFSAGPPAYASTDGVTAPPTVTSMSAPTTSNSVEMDLLGSLADVFSSNALAI
VPADSIYVETNGQANAGPAPSFSTSQPSTQSFDDPFGDSPFKAFTSTDTDSTPQQNFGAS
FQPPPPAFTSEVSHPDTAHNFGFGDSFSAVANPDPASQNVQPPSNSPGFPQEQFATSQSG
IDILAGILPPSGPPVQSGPSIPTSQFPPSGNNMYEGFHSQPPVSTAPNLPGQTPFGQAVQ
PYNMVPHSQNMTGAMPFNSGGFMHQPGSQTPYSTPSGPAGQFMAHQGHGMPPSHGPQRTQ
SGPVTLQGNNNVMGDMFSQATPNSLTSSSSHPDLTPLTGAIEIVPPPQKKFEPKSSVWAD
TLSRGLVNFNISGSKTNPLADIGVDFEAINRREKRLEKQTNTPATSTINMGKAMGSGTGL
GRSGATAMRPPPNPMTGSGMPMGGGMGVGSYGGMNQNQPMGMGMGAGMNQNQPMGMGMGP
GMNMNMNMGGYGQGYPMQPQNPGMVPSPNMPGNNYNPMMGQGGYNPQQSYGGGYR

MKKAFGQTVRDLKRGVNKKVLKVPGIEQKVLDATSNESWGPHGSLLADIAHASRNYHEYQ
ITMGVLWKRLSDSGKNWRHVYKALTVLEYMVGHGSERVIEEVKEHAYQITTLSGFQYIDS
SGKDQGSNVRKKAQSLVALVNDKERITEVREKAAANRDKYHNSMHRPSGGYGDKYDYEGR
YGDRDEGRSSYGKEREYGYRDDDRNSRDGDRYSRDSEDRYGRDGNTDDEYRGRSRSVDNY
NGSRGRSSDRERPIEDDGQSSSRDSGAPADDHSQDGRGGLERKFSEQNIGAAPPSYEEAV
SESRSPVYSERDGGETPQVAPPGAAASPLAENISVDNKAADFVNESSPQQVEAFDEFDPR
GSVSAACAPTAGASVPAPIPPTVVSTPAPPASINAEMDLLGSLSDVFSPNPLAIVTSDST
SVETNGQANTGLAPSFSTSQSSTQPFDDPFGDSPFKAITSADTETSQHQSFGVPFQPTPP
TSNPNNEHNFGFGEAFSAVTDSEPGVQNMQAPPNLSVFPQEQFDTSQSEIDILAGILPPS
GPPVSLSPQPDSTMPTSQFHPNGNSYESYHHQAAPTDLNMQGQTPFGQASQQFNMVSHSQ
NHHEGMQFNNGGFTQQPGYAGPATSQPPQYTPGVSSHPPSESFPHQPGSATSASSQTPYA
TTPNVSAGQFDGGSFMTQQPYGVTQQVHVVPSHIPQRTQSGPVAAFGNNNNIVGDMHQPG
STPSSSSQTPYPTTPNAPSGQFDGGNFMTQQPYGVIPQVHGVPSHIPQRTQSGPVAAHGN
SNNVVGDMFSPAGLSSLETSASQPSLTPLTGAIEIVPQNQKKFEPKSTIWADTLSRGLVN
FNISGPKTNPLADIGVDFEAINRKEKRLEKPTITQQQVTSTINMGKAMGSGTGLGRAGAG
AMRPPTNSMVGSSMPTGMNVGGYGGMNQHQPIGMNQNHPMGMNQNLSMGMNQNYPMGMNQ
NYPMGMGMNMNMGGYGQGYPMQPQQGMGMAPPGAPQGMTGAYNPMMGQGGYNPQQQQPYG
GGYR

www.000webhost.com

Other information
Ka divergence:0.226584KaKs divergence:0.177246
GC content 1 (%):47GC content 2 (%):46GC content divergence:-0.011
Length 1 (bp):2688Length 2 (bp):3075Length divergence:0.067
MFE 1 (kcal):-864.74MFE 2 (kcal):-940.28MFE divergence0.042