Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G43230-AT3G59350
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein kinase superfamily protein
Function (paralog2):Protein kinase superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:2.2179454214808
Log2 mRNA fold difference:0.94592836644731
Log2 TE fold difference:1.2113520636744
Sequences
Protein sequence

MDRDFHRRGQVVNQDQRATNSNVFTKFENTYLQITAHLCVLVKTQANDRTQSNFVRLDKP
RAVDDLDIGKRGKMRRWLCCSCRVQESYPSAENNRLKTPPTRHYDYGRNNKKTPAPVKPP
VLKEPPPIDVPAMSLVELKEKTQNFGSKALIGEGSYGRVYYANFNDGKAVAVKKLDNASE
PETNVEFLTQVSKVSRLKSDNFVQLLGYCVEGNLRVLAYEFATMRSLHDILHGRKGVQGA
QPGPTLEWMQRVRVAVDAAKGLEYLHEKVQPAVIHRDIRSSNVLIFEDFKAKIADFNLSN
QAPDMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPR
GQQSLVTWATPRLSEDKVKQCVDPKLKGEYPPKAVAKLAAVAALCVQYEAEFRPNMSIVV
KALQPLLRSATAAAPPTPQP

MYPMDSDYHRRGLVANDRSPAQFVRLDKPRAVDDLYIGKREKMRRWLCCACHVEEPYHSS
ENEHLRSPKHHNDFGHHTRKPQAAVKPDALKEPPSIDVPALSLDELKEKTDNFGSKSLIG
EGSYGRAYYATLKDGKAVAVKKLDNAAEPESNVEFLTQVSRVSKLKHDNFVELFGYCVEG
NFRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWIQRVRIAVDAARGLEYLHEKVQPA
VIHRDIRSSNVLLFEDFKAKIADFNLSNQSPDMAARLHSTRVLGTFGYHAPEYAMTGQLT
QKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLSEDKVKQCVDPKLKGEYPP
KAVAKLAAVAALCVQYESEFRPNMSIVVKALQPLLRSSTAAAVPVQEA

www.000webhost.com

Other information
Ka divergence:-0.0381196KaKs divergence:-0.3125
GC content 1 (%):43GC content 2 (%):45GC content divergence:0.023
Length 1 (bp):1323Length 2 (bp):1227Length divergence:-0.038
MFE 1 (kcal):-388.7MFE 2 (kcal):-378.64MFE divergence-0.013