Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G43240-AT3G59360
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Nucleotide-sugar transporter family protein
Function (paralog2):UDP-galactose transporter 6

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:1.6847503678021
Log2 mRNA fold difference:1.6324046465621
Log2 TE fold difference:0.060060276740481
Sequences
Protein sequence

MKNGMAECSVCRSRLVSPSSKAISRAYDNYNYKIRVSSKQRALNVFLVVGDCMLVGLQPV
LVYMSKVDGKFNFSPISVNFLTEIAKVIFAMVMLLFQARHQKVGEKPLLSLSTFVQAARN
NMLLAVPAGLYAINNYLKFTMQLYFNPATVKMLSNLKVLVIAVLLKMIMKRRFSIIQWEA
LALLLIGISINQLRSLPEGATTVAVPIATGAYICTFIFVTVPSLASVYNEYALKSQYDTS
IYLQNLFLYGYGAIFNFLGILGTVIYKGPGSFDILQGHSRATMFLILNNAAQGILSSFFF
KYADTILKKYSSTVATIFTGIASAALFGHILTMNFLLGISIVFISMHQFFSPLSKAKDEQ
QNGNIELVDAKDGHRAKDSFINMAAGATEEASHRIESDDRVPLLPR

MKNGIAECPACHSKLVSPGSKTISRAYDDHKIRVSSKQRVLNVLLVVGDCMLVGLQPVLV
YMSKVDGKFNFSPISVNFLTEIAKVIFAIVMLLIQARHQKVGEKPLLSVSTFVQAARNNV
LLAVPALLYAINNYLKFTMQLYFNPATVKMLSNLKVLVIAVLLKMVMKRRFSIIQWEALA
LLLIGISVNQLRSLPEGATAIGIPLATGAYVCTVIFVTVPSMASVFNEYALKSQYDTSIY
LQNLFLYGYGAIFNFLGILGTVIYKGPGSFDILQGHSRATMFLILNNAAQGILSSFFFKY
ADTILKKYSSTVATIFTGIASAALFGHVITMNFLLGISIVFISMHQFFSPLAKARDEQQQ
NGNLELGNTKDTHRANESFINMAAGANEEASHRGESDDRTPLLPR

www.000webhost.com

Other information
Ka divergence:0.299139KaKs divergence:0.454052
GC content 1 (%):41GC content 2 (%):42GC content divergence:0.012
Length 1 (bp):1221Length 2 (bp):1218Length divergence:-0.001
MFE 1 (kcal):-342.58MFE 2 (kcal):-332.96MFE divergence-0.014