Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G43290-AT3G59450
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Calcium-binding EF-hand family protein
Function (paralog2):Calcium-binding EF-hand family protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-5.7254633016264
Log2 mRNA fold difference:-5.9751709607293
Log2 TE fold difference:0.33100209513859
Sequences
Protein sequence

MVRIFLLYNILNSFLLSLVPKKLRTLFPLSWFDKTLHKNSPPSPSTMLPSPSSSSAPTKR
IDPSELKRVFQMFDKNGDGRITKEELNDSLENLGIYIPDKDLTQMIHKIDANGDGCVDID
EFESLYSSIVDEHHNDGETEEEDMKDAFNVFDQDGDGFITVEELKSVMASLGLKQGKTLD
GCKKMIMQVDADGDGRVNYKEFLQMMKGGGFSSSN

MPIFQWLKRCLCGDTNITIDQAIALVDEEIANLRKLERGYQTNIRNAENARDQTNVQIER
DSFNDTIRLLQAECNLINLEIPTLNEEKFAITRLKSAKHFFGAVSSLKEGKALECCKEMI
KQVDEDGHGRVDYKEFLQMMKTGDFSNR

www.000webhost.com

Other information
Ka divergence:0.975124KaKs divergence:0.882925
GC content 1 (%):44GC content 2 (%):40GC content divergence:-0.048
Length 1 (bp):648Length 2 (bp):447Length divergence:-0.184
MFE 1 (kcal):-191.17MFE 2 (kcal):-114.7MFE divergence-0.25