Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G43490-AT3G59570
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Ypt/Rab-GAP domain of gyp1p superfamily protein
Function (paralog2):Ypt/Rab-GAP domain of gyp1p superfamily protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-1.4594402256367
Log2 mRNA fold difference:-1.5099885995718
Log2 TE fold difference:0.071072294748373
Sequences
Protein sequence

MCSGGEGKQWSCGKAGVVSLQKVGSLVRDLSEPCLSQSRIQVVITIGKMLKPEKWQASFD
SDGRVSGFQKALKLIILGGIDPSIRAEVWEFLLGCYALSSTSEYRNQLRVARRKRYNDLL
KQCQTMHSSVGTGSLAYVVGSKVMDMRKSYRDEAVKVATTDENREDAFIDNNDNANTENH
HSDWSNNGTDTSHLHRRGSSSESVDLVSGRESPESVVYNTSSFVSASSPYGYASPDGYFD
FPSLPVTDLFGRNSLDKIEVSTPDEDASLKSELRSEDEGMHNFRIDKNADLIREQRRSTP
EIKVMHSDSVGPSSYTGRNAEIVDGLRISDVPEMASVKDTPSRVGNVTEDRVSEWLWTLH
RIVVDVVRTDSHLEFYEDPGNLGRMSDILAVYAWVDPATGYCQGMSDLVSPFVVLFEDNA
DAFWCFEMLIRRTRANFQMEGPTGVMDQLQSLWHILQITDKDIFSHLSRIGAESLHFAFR
MLLVLFRRELSFNEALRMWEMMWAADYDESVTETLENDCLEPLVIQLPRKSEPEVSEEMI
EDGIGNSTKREPMISKSGPISKSSGLLSRSGLLPKSGPLPKTAGPFSDESEIKSASSSYH
FCGLTRSLWSRNDRTTHVPCVVSSIKKGDDALPVFCVAAILIMNRHKIMKETRSIDDMIQ
IFNDKVLVFRVRRCIRTAMKLRRKYMYKSQVIKTKSHTQSQNLNQVHIQHQTHMESQRPE
EIQSHGENQSQTPSFHHSPATQNGD

MFSAGEGKKWTRRKAGLVSLQKVASLVRDLREPCLSQSRIQVVLTIGKMLKPEKWQALFD
GDGKVSSFHKALKLIILGGIDPSIRAEVWEFLLGCYALSSTSEYRTQLRVARRERYNELL
KQCQMMHSTVGTGSLAYVVGSKVMDMRKSYKNEVVKEDIDESREACLDGHENTDNHGDWS
NNDTEKSPVRRSGSSSESVDLVSPDSTIYETSSFVPPSSPYGFPSPGPFADDIFDFPSLP
VTDLFGRSSLGKKGLSTPDEETSTQSDLRSEDERMHSFRIDKNADLVIEPHGSSYNDVTA
SINSEIEVVHLQSVEKLSHSVCTSEIVDGLRISDVPETPSARETHTRGGTVKEDRVSEWL
WTLHRIVVDVVRTDSHLEFYEDPGNLGRMSDILAVYAWVDPATGYCQGMSDLVSPFVFLF
EDNADAFWCFEMLIRRTRANFQMEGPTGVMDQLQSLWRILQLTDKEMFSHLSRIGAESLH
FAFRMLLVLFRRELSFNKALRMWEMMWAADFDESFAETLEKDCLKPLVVQLPKRSGVDMG
DHKIDDGNGTTTNSESTSKSDRTSKSSLLSKSGLLPESGPLPKTGPLSDDFGMKPAVSSC
GKGDDPLPVFCVAAILIMNRHKIMKETRSIDDMIKICNDKLLAIRVRRCIRTAIKLRKKY
LYKNQVIKIESHIQSQNHKHHEIQNQTAMENQIPEEITSHDENCSQRPSLCNGPVMPLRE

www.000webhost.com

Other information
Ka divergence:0.0912233KaKs divergence:-0.155303
GC content 1 (%):42GC content 2 (%):42GC content divergence:0
Length 1 (bp):2238Length 2 (bp):2163Length divergence:-0.017
MFE 1 (kcal):-666MFE 2 (kcal):-649MFE divergence-0.013