Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G43500-AT3G59580
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Plant regulator RWP-RK family protein
Function (paralog2):Plant regulator RWP-RK family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.29419104014651
Log2 mRNA fold difference:0.23665368225658
Log2 TE fold difference:-0.53268386510245
Sequences
Protein sequence

MENPFASREKGFGNYSDFPTEQMDGLSSNFGSGVRNLISDDMFNPSSELMNFDSLAAWCN
SPSATDILFAQYGLSNSQPMPFGAFTSFHVADPKATSLTRSFYDLESSYYGEERSSAQEM
NSQFHRSSDSDELSGKRRKVVNQKIGFPNVLNCTIPRSLSHSLDEKMLKALSLFMESSGS
GEGILAQVWTPIKTGDQYLLSTCDQAYLLDPRFSQYREVSRRFTFAAEANQCSFPGLPGR
VFISGVPEWTSNVMYYKTDEYLRMKHAIDNEVRGSIAIPILEASGTSCCAVMELVTSKEK
PNFDMEMDSVCRALQAVNLRTAAIPRPQYLSSSQRDALAEIQDVLRTVCHAHKLPLALAW
IPCRKDQSIRVSGQKSGENCILCIEETACYVNDMEMEGFVHACLEHCLREKEGIVGKAFI
SNQPFFSSDVKAYDISEYPIVQHARKYGLNAAVAIKLRSTYTGEDDYILELFLPVSMKGS
LEQQLLLDSLSGTMQRICRTLRTVSEVGSTKKEGTKPGFRSSDMSNFPQTTSSENFQTIS
LDSEFNSTRSMFSGMSSDKENSITVSQGTLEQDVSKARTPEKKKSTTEKNVSLSALQQHF
SGSLKDAAKSLGGETSAYFQAWVYFFCPTTLKRICRQHGIMRWPSRKINKVNRSLRKIQT
VLDSVQGVEGGLKFDSATGEFIAVRPFIQEIDTQKGLSSLDNDAHARRSQEDMPDDTSFK
LQEAKSVDNAIKLEEDTTMNQARPGSFMEVNASGQPWAWMAKESGLNGSEGIKSVCNLSS
VEISDGMDPTIRCSGSIVEPNQSMSCSISDSSNGSGAVLRGSSSTSMEDWNQMRTHNSNS
SESGSTTLIVKASYREDTVRFKFEPSVGCPQLYKEVGKRFKLQDGSFQLKYLDDEEEWVM
LVTDSDLQECLEILHGMGKHSVKFLVRDLSAPLGSSGGSNGYLGTGL

MENPSASRDNKGFCFPDIPVEEMDGWVKNLISEEDMFSSSSTSELMNFESFASWCNSPSA
ADILFTQYGLSTSQSIIPFGGLEGSYACEKRPLDCTSVPRSLSHSLDEKMLKALSLFMEF
SGEGILAQFWTPIKTGDQYMLSTCDQAYLLDSRLSGYREASRRFTFSAEANQCSYPGLPG
RVFISGVPEWTSNVMYYKTAEYLRMKHALDNEVRGSIAIPVLEASGSSCCAVLELVTCRE
KPNFDVEMNSVCRALQAVNLQTSTIPRRQYLSSNQKEALAEIRDVLRAVCYAHRLPLALA
WIPCSYSKGANDELVKVYGKNSKECSLLCIEETSCYVNDMEMEGFVNACLEHYLREGQGI
VGKALISNKPSFSSDVKTFDICEYPLVQHARKFGLNAAVATKLRSTFTGDNDYILEFFLP
VSMKGSSEQQLLLDSLSGTMQRLCRTLKTVSDAESIDGTEFGSRSVEMTNLPQATVSVGS
FHTTFLDTDVNSTRSTFSNISSNKRNEMAGSQGTLQQEISGARRLEKKKSSTEKNVSLNV
LQQYFSGSLKDAAKSLGVCPTTLKRICRQHGIMRWPSRKINKVNRSLRKIQTVLDSVQGV
EGGLKFDSVTGEFVAVGPFIQEFGTQKSLSSHDEDALARSQGDMDEDVSVEPLEVKSHDG
GGVKLEEDVETNHQAGPGSLKKPWTWISKQSGLIYSDDTDIGKRSEEVNKDKEDLCVRRC
LSSVALAGDGMNTRIERGNGTVEPNHSISSSMSDSSNSSGAVLLGSSSASLEQNWNQIRT
HNNSGESGSSSTLTVKATYREDTVRFKLDPYVVGCSQLYREVAKRFKLQEGAFQLKYLDD
EEEWVMLVTDSDLHECFEILNGMRKHTVKFLVRDIPNTAMGSSAGSNGYLGTGT

Other information
Ka divergence:-0.0925853KaKs divergence:-0.309664
GC content 1 (%):42GC content 2 (%):42GC content divergence:0
Length 1 (bp):2844Length 2 (bp):2685Length divergence:-0.029
MFE 1 (kcal):-858.11MFE 2 (kcal):-799.19MFE divergence-0.036