Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G43630-AT3G59640
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):glycine-rich protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-2.0717336455689
Log2 mRNA fold difference:-1.7298899080625
Log2 TE fold difference:-0.34498440471355
Sequences
Protein sequence

MSFTQANCFRPSYYPARITRPNCISSVPIRSSVRFDHFPRTSFTLRATAAVSTQFSPLLD
HRRRLPTGKSKQSSAVCLFGGKDKPDGSDEISPWKAIEKAMGKKSVEDMLREQIQKKDFY
DTDSGGNMPPRGGGSGGGGGNGEERPEGSGGEDGGLAGIADETLQVVLATLGFIFLYTYI
ITGEELVKLARDYIRFLMGRPKTVRLTRAMDSWNGFLEKMSRQRVYDEYWLEKAIINTPT
WYDSPEKYRRVIKAYVDSNSDEAYVESNSDEVSY

MSSTQANLCRPSLFCARTTQTRHVSSAPFMSSLRFDYRPLPKLAIRASASSSMSSQFSPL
QNHRCRNQRQGPVVCLLGGKDKSNGSNELSSTWEAIEKAMGKKSVEDMLREQIQKKDTGG
IPPRGRGGGGGGRNGGNNGSGGSSGEDGGLASFGDETLQVVLATLGFIFLYFYIINGEEL
FRLARDYIRYLIGRPKSVRLTRVMEGWSRFFEKMSRKKVYNEYWLKIKRSSTSLPGLVTR
ANTNAS

www.000webhost.com

Other information
Ka divergence:0.262476KaKs divergence:0.258739
GC content 1 (%):45GC content 2 (%):45GC content divergence:0
Length 1 (bp):825Length 2 (bp):741Length divergence:-0.054
MFE 1 (kcal):-260.02MFE 2 (kcal):-222.3MFE divergence-0.078