Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G43680-AT3G59690
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):IQ-domain 14
Function (paralog2):IQ-domain 13

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-3.5949286253479
Log2 mRNA fold difference:-5.1041047775904
Log2 TE fold difference:1.1031571180775
Sequences
Protein sequence

MVKKGSWFSAIKRVFTPHSKEKLANQEPERKSGKEKKKKGFGKLRHGETNSFLPIFREPS
SIEKILGEAERDHNLVFRPPTPDRPNPYSASPPPRPASPRVASPRPTSPRVASPRVPSPR
AEVPRTLSPKPPSPRAEVPRSLSPKPPSPRADLPRSLSPKPFDRSKPSSASANAPPTLRP
ASTRVPSQRITPHSVPSPRPSSPRGASPQAISSKPPSPRAEPPTLDTPRPPSPRAASLRA
DPPRLDAARPTTPRPPSPLADAPRLDAPRPTTPKPPSPRSDPPRLDAPRPTTPKPPSPRS
VSPRAVQRREIVYRPEPTLPVQHASATKIQGAFRGYMARKSFRALKGLVRLQGVVRGYSV
KRQTINAMKYMQQVVRVQSQIQSRRIKMLENQAQVEKDEAKWAASEAGNDNWDDSVLTKE
ERDSRSQRKTDAIIKRERSMAYAYSRKLWKNSPKSTQDNRSFPQWWNWVDRQNPLASPAP
SYSQPQRDFRLTPSRLCPSPLSQSSKQHHIRLDNHFDTSTPRSSRSTFHTPSRPIHTGTS
RYSRGRLRGQDSPFKDDDSLTSCPPFPSYMAPTVSAKAKVRPNSNPKERVMGTPVSEKRR
MSYPPTQDTFRWNKGSLVMSNSSSHRGPGSPGGVVLEKHKTLKSVGNLSIGSTASMATTV
GRKEFNRFV

MGKKGSWFSAIKRVFTPHSKEKQLSNNNQEPEIKSENKEKKKKGFGKKLRNGETNSFLPI
FRQPSSIEKILSEAEREHNLVFRPPTPTDRANSSSTSVASPLVRPASPKVPSQRYVSSPK
PISPRVAYPQVHYPKPPSPKPPSPRAVSPRIVQRREFVHRPEPSLLVKNAYAIKIQAAFR
GYMARRSFRALKGLVRLQGVVRGHSVKRQTMNAMKYMQLLVRVQTQVQSRRIQMLENRAR
NDKDDTKLVSSRMSDDWDDSVLTKEEKDVRLHRKIDAMIKRERSMAYAYSHQLWKNSPKS
AQDIRTSGFPLWWNWVDRQKNQNQPFRLTPTRPSLSPQPQSSNQNHFRLNNSFDTSTPNS
SKSTFVTPSRPIHTPQPYSSSVSRYSRGGGRATQDSPFKDDDSLTSCPPFSAPSYMAPTV
SAKAKLRANSNPKERMDRTPVSTNEKRRSSFPLGSFKWNKGSLFMSNNSNNKGPGSSSSG
AVVLEKHKTLKSVGNLSIDSTVSMPATIGRRAFNRFA

Other information
Ka divergence:-0.0139993KaKs divergence:-0.331677
GC content 1 (%):49GC content 2 (%):44GC content divergence:-0.054
Length 1 (bp):2010Length 2 (bp):1554Length divergence:-0.128
MFE 1 (kcal):-587.32MFE 2 (kcal):-436.17MFE divergence-0.148