Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G43690-AT2G43700
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Concanavalin A-like lectin protein kinase family protein
Function (paralog2):Concanavalin A-like lectin protein kinase family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.71349274877619
Log2 mRNA fold difference:0.33967335819482
Log2 TE fold difference:0.29990072389723
Sequences
Protein sequence

MSMSCKINWLMVLVIIALSNLESSLGRLVFEGSAGLMNGFTTLTNTKKHAYGQAFNDEPF
PFKNSVNGNMTSFSFTFFFAIVPEHIDKGSHGIAFVISPTRGIPGASADQYLGIFNDTND
GNSSNHIIAVELDIHKDDEFGDIDDNHVGININGMRSIVSAPAGYYDQNGQFKNLSLISG
NLLRVTILYSQEEKQLNVTLSPAEEANVPKWPLLSLNKDLSPYLSKNMYIGFTASTGSVG
AIHYMWMWYVFTFIIVPKLDFDIPTFPPYPKAESQVKLIVLVTFLTLALFVALAASALIV
FFYKRHKKLLEVLEEWEVECGPHRFSYKELFNATNGFKQLLGEGGFGPVFKGTLSGSNAK
IAVKRVSHDSSQGMRELLAEISTIGRLRHPNLVRLLGYCRYKEELYLVYDFLPNGSLDKY
LYGTSDQKQLSWSQRFKIIKDVASALSYLHHGWIHVVIHRDIKPANVLIDDKMNASLGDF
GLAKVYDQGYDPQTSRVAGTFGYMAPEIMRTGRPTMGTDVYAFGMFMLEVSCDRKLFEPR
AESEEAILTNWAINCWENGDIVEAATERIRQDNDKGQLELVLKLGVLCSHEAEEVRPDMA
TVVKILNGVSELPDNLLDIVRSEKLENWYERYSKVIDPVTTEESIGNLAITEPILPSGRP
RLFL

MSRTIGSRVIFLILALFCCTENSRGKLVMQGSAGFFKGYRTLTSTKKHAYGQAFEDEIVP
FKNSANDTVTSFSVTFFFAIAPEDKHKGAHGMAFVISPTRGITGASADQYLGIFNKANNG
DSSNHVIAVELDINKDEEFGDINDNHVGININGMRSIKFAPAGYYDQEGQFKDLSLISGS
LLRVTILYSQMEKQLNVTLSSPEEAYYPNKPLLSLNQDLSPYILENMYVGFSASTGSVRA
MHYMLSWFVHGGVDVPNLDLGIPTFPPYPKEKSLVYRIVLVTSLALVLFVALVASALSIF
FYRRHKKVKEVLEEWEIQCGPHRFAYKELFKATKGFKQLLGKGGFGQVFKGTLPGSDAEI
AVKRISHDSKQGMQEFLAEISTIGRLRHQNLVRLQGYCRYKEELYLVYDFMPNGSLDKYL
YHRANQEQLTWNQRFKIIKDIASALCYLHHEWVQVVIHRDIKPANVLIDHQMNARLGDFG
LAKLYDQGYDPQTSRVAGTFWYIAPELIRSGRATTGTDVYAFGLFMLEVSCGRRLIERRT
ASDEVVLAEWTLKCWENGDILEAVNDGIRHEDNREQLELVLKLGVLCSHQAVAIRPDMSK
VVQILGGDLQLPDNLLDIVKAEKVRMWSETSESVLGVLTSQGSIGTLTLTEPFTSRGR

Other information
Ka divergence:0.0213322KaKs divergence:-0.000766284
GC content 1 (%):42GC content 2 (%):44GC content divergence:0.023
Length 1 (bp):1995Length 2 (bp):1977Length divergence:-0.005
MFE 1 (kcal):-579.01MFE 2 (kcal):-605.12MFE divergence0.022