Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G43690-AT3G59700
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Concanavalin A-like lectin protein kinase family protein
Function (paralog2):lectin-receptor kinase

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.8271390982258
Log2 mRNA fold difference:1.1913562422668
Log2 TE fold difference:-0.25999465368047
Sequences
Protein sequence

MSMSCKINWLMVLVIIALSNLESSLGRLVFEGSAGLMNGFTTLTNTKKHAYGQAFNDEPF
PFKNSVNGNMTSFSFTFFFAIVPEHIDKGSHGIAFVISPTRGIPGASADQYLGIFNDTND
GNSSNHIIAVELDIHKDDEFGDIDDNHVGININGMRSIVSAPAGYYDQNGQFKNLSLISG
NLLRVTILYSQEEKQLNVTLSPAEEANVPKWPLLSLNKDLSPYLSKNMYIGFTASTGSVG
AIHYMWMWYVFTFIIVPKLDFDIPTFPPYPKAESQVKLIVLVTFLTLALFVALAASALIV
FFYKRHKKLLEVLEEWEVECGPHRFSYKELFNATNGFKQLLGEGGFGPVFKGTLSGSNAK
IAVKRVSHDSSQGMRELLAEISTIGRLRHPNLVRLLGYCRYKEELYLVYDFLPNGSLDKY
LYGTSDQKQLSWSQRFKIIKDVASALSYLHHGWIHVVIHRDIKPANVLIDDKMNASLGDF
GLAKVYDQGYDPQTSRVAGTFGYMAPEIMRTGRPTMGTDVYAFGMFMLEVSCDRKLFEPR
AESEEAILTNWAINCWENGDIVEAATERIRQDNDKGQLELVLKLGVLCSHEAEEVRPDMA
TVVKILNGVSELPDNLLDIVRSEKLENWYERYSKVIDPVTTEESIGNLAITEPILPSGRP
RLFL

MSRELIILCQPILVLFLTLFYNSHGYFVSQGSVGIGFNGYFTLTNTTKHTFGQAFENEHV
EIKNSSTGVISSFSVNFFFAIVPEHNQQGSHGMTFVISPTRGLPGASSDQYLGIFNKTNN
GKASNNVIAIELDIHKDEEFGDIDDNHVGININGLRSVASASAGYYDDKDGSFKKLSLIS
REVMRLSIVYSQPDQQLNVTLFPAEIPVPPLKPLLSLNRDLSPYLLEKMYLGFTASTGSV
GAIHYLMGWLVNGVIEYPRLELSIPVLPPYPKKTSNRTKTVLAVCLTVSVFAAFVASWIG
FVFYLRHKKVKEVLEEWEIQYGPHRFAYKELFNATKGFKEKQLLGKGGFGQVYKGTLPGS
DAEIAVKRTSHDSRQGMSEFLAEISTIGRLRHPNLVRLLGYCRHKENLYLVYDYMPNGSL
DKYLNRSENQERLTWEQRFRIIKDVATALLHLHQEWVQVIIHRDIKPANVLIDNEMNARL
GDFGLAKLYDQGFDPETSKVAGTFGYIAPEFLRTGRATTSTDVYAFGLVMLEVVCGRRII
ERRAAENEEYLVDWILELWENGKIFDAAEESIRQEQNRGQVELVLKLGVLCSHQAASIRP
AMSVVMRILNGVSQLPDNLLDVVRAEKFREWPETSMELLLLDVNTSSSLELTDSSFVSHG
R

www.000webhost.com

Other information
Ka divergence:0.000937097KaKs divergence:0.0660161
GC content 1 (%):42GC content 2 (%):42GC content divergence:0
Length 1 (bp):1995Length 2 (bp):1986Length divergence:-0.002
MFE 1 (kcal):-579.01MFE 2 (kcal):-564.8MFE divergence-0.012