Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G43750-AT3G59760
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):O-acetylserine (thiol) lyase B
Function (paralog2):O-acetylserine (thiol) lyase isoform C

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-2.3171050592062
Log2 mRNA fold difference:-1.8624902890632
Log2 TE fold difference:-0.40694605956017
Sequences
Protein sequence

MAATSSSAFLLNPLTSRHRPFKYSPELSSLSLSSRKAAAFDVSSAAFTLKRQSRSDVVCK
AVSIKPEAGVEGLNIADNAAQLIGKTPMVYLNNVVKGCVASVAAKLEIMEPCCSVKDRIG
YSMITDAEEKGLITPGKSVLVESTSGNTGIGLAFIAASKGYKLILTMPASMSLERRVLLR
AFGAELVLTEPAKGMTGAIQKAEEILKKTPNSYMLQQFDNPANPKIHYETTGPEIWEDTR
GKIDILVAGIGTGGTITGVGRFIKERKPELKVIGVEPTESAILSGGKPGPHKIQGIGAGF
VPKNLDLAIVDEYIAISSEEAIETSKQLALQEGLLVGISSGAAAAAAIQVAKRPENAGKL
IAVVFPSFGERYLSTQLFQSIREECEQMQPEL

MVAMIMASRFNREAKLASQILSTLLGNRSCYTSMAATSSSALLLNPLTSSSSSSTLRRFR
CSPEISSLSFSSASDFSLAMKRQSRSFADGSERDPSVVCEAVKRETGPDGLNIADNVSQL
IGKTPMVYLNSIAKGCVANIAAKLEIMEPCCSVKDRIGYSMVTDAEQKGFISPGKSVLVE
PTSGNTGIGLAFIAASRGYRLILTMPASMSMERRVLLKAFGAELVLTDPAKGMTGAVQKA
EEILKNTPDAYMLQQFDNPANPKIHYETTGPEIWDDTKGKVDIFVAGIGTGGTITGVGRF
IKEKNPKTQVIGVEPTESDILSGGKPGPHKIQGIGAGFIPKNLDQKIMDEVIAISSEEAI
ETAKQLALKEGLMVGISSGAAAAAAIKVAKRPENAGKLIAVVFPSFGERYLSTPLFQSIR
EEVEKMQPERVSG

www.000webhost.com

Other information
Ka divergence:-0.156809KaKs divergence:-0.316271
GC content 1 (%):46GC content 2 (%):45GC content divergence:-0.011
Length 1 (bp):1179Length 2 (bp):1302Length divergence:0.05
MFE 1 (kcal):-373.8MFE 2 (kcal):-419.35MFE divergence0.057