Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G43810-AT3G59810
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Small nuclear ribonucleoprotein family protein
Function (paralog2):Small nuclear ribonucleoprotein family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.03779471214142
Log2 mRNA fold difference:-0.057117985569608
Log2 TE fold difference:-0.10231378036603
Sequences
Protein sequence

MSGVGEKASGTTKTPADFLKSIRGKPVVVKLNSGVDYRGILTCLDGYMNIAMEQTEEYVN
GQLKNTYGDAFVRGNNVLYISTTKGTLSDGA

MSGVEEKVSGTTKTPADFLKSIRGRPVVVKLNSGVDYRGTLTCLDGYMNIAMEQTEEYVN
GQLKNKYGDAFIRGNNVLYISTVNMTVADGA

Other information
Ka divergence:0.132015KaKs divergence:0.367388
GC content 1 (%):43GC content 2 (%):44GC content divergence:0.011
Length 1 (bp):276Length 2 (bp):276Length divergence:0
MFE 1 (kcal):-69.8MFE 2 (kcal):-70MFE divergence0.001