Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G43820-AT2G43840
Species:Arabidopsis
Duplication type:TD
Function (paralog1):UDP-glucosyltransferase 74F2
Function (paralog2):UDP-glycosyltransferase 74 F1

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-4.0481031694659
Log2 mRNA fold difference:-4.0566062553417
Log2 TE fold difference:-0.061061082244124
Sequences
Protein sequence

MEHKRGHVLAVPYPTQGHITPFRQFCKRLHFKGLKTTLALTTFVFNSINPDLSGPISIAT
ISDGYDHGGFETADSIDDYLKDFKTSGSKTIADIIQKHQTSDNPITCIVYDAFLPWALDV
AREFGLVATPFFTQPCAVNYVYYLSYINNGSLQLPIEELPFLELQDLPSFFSVSGSYPAY
FEMVLQQFINFEKADFVLVNSFQELELHENELWSKACPVLTIGPTIPSIYLDQRIKSDTG
YDLNLFESKDDSFCINWLDTRPQGSVVYVAFGSMAQLTNVQMEELASAVSNFSFLWVVRS
SEEEKLPSGFLETVNKEKSLVLKWSPQLQVLSNKAIGCFLTHCGWNSTMEALTFGVPMVA
MPQWTDQPMNAKYIQDVWKAGVRVKTEKESGIAKREEIEFSIKEVMEGERSKEMKKNVKK
WRDLAVKSLNEGGSTDTNIDTFVSRVQSK

MEKMRGHVLAVPFPSQGHITPIRQFCKRLHSKGFKTTHTLTTFIFNTIHLDPSSPISIAT
ISDGYDQGGFSSAGSVPEYLQNFKTFGSKTVADIIRKHQSTDNPITCIVYDSFMPWALDL
AMDFGLAAAPFFTQSCAVNYINYLSYINNGSLTLPIKDLPLLELQDLPTFVTPTGSHLAY
FEMVLQQFTNFDKADFVLVNSFHDLDLHVKELLSKVCPVLTIGPTVPSMYLDQQIKSDND
YDLNLFDLKEAALCTDWLDKRPEGSVVYIAFGSMAKLSSEQMEEIASAISNFSYLWVVRA
SEESKLPPGFLETVDKDKSLVLKWSPQLQVLSNKAIGCFMTHCGWNSTMEGLSLGVPMVA
MPQWTDQPMNAKYIQDVWKVGVRVKAEKESGICKREEIEFSIKEVMEGEKSKEMKENAGK
WRDLAVKSLSEGGSTDININEFVSKIQIK

Other information
Ka divergence:0.151214KaKs divergence:0.32931
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):1350Length 2 (bp):1350Length divergence:0
MFE 1 (kcal):-407.5MFE 2 (kcal):-390.1MFE divergence-0.022