Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G43850-AT3G59830
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Integrin-linked protein kinase family
Function (paralog2):Integrin-linked protein kinase family

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-1.2278169152099
Log2 mRNA fold difference:-1.7492718496396
Log2 TE fold difference:0.5100905538384
Sequences
Protein sequence

MENITAQLKRGISRQFSTGSIRRTLSRQFTRQSSLDPRRTNMRFSFGRQSSLDPIRRSPD
SSKSDDEPHMSVPENLDSTMQLLFMASKGDVRGIEELLDEGIDVNSIDLDGRTALHIAAC
EGHLGVVKALLSRRANIDARDRWGSTAAADAKYYGNLDVYNLLKARGAKVPKTRKTPMTV
SNPREVPEYELNPLEVQVRKSDGISKGAYQVAKWNGTRVSVKILDKDSYSDPERINAFRH
ELTLLEKVRHPNVIQFVGAVTQNIPMMIVVEYNPKGDLSVYLQKKGRLSPSKALRFALDI
ARGMNYLHECKPDPIIHCDLKPKNILLDRGGQLKISGFGMIRLSKISQDKAKVANHKAHI
DLSNYYIAPEVYKDEIFDLRVDAHSFGVILYEITEGVPVFHPRPPEEVARMMCLEGKRPV
FKTKSRSYPPDIKELIEKCWHPEAGIRPTFSEIIIRLDKIVANCSKQGWWKDTFKFPWK

MDNIAAQLKRGISRQFSTGSMRRTLSRQFTRQNSLDPRRNNMRFSFGRQSSLDPIRRSPE
SLSCEPHMSVPENLDSTMQLLFMASKGDVNGVEELLNEGIDVNSIDLDGRTALHIASCEG
HYDVVKVLLSRRANIDARDRWGSTAAVDAKYYGNVEVYNLLKARGAKAPKTRKTPMTVGN
PKEVPEYELNPLELQVRKVDGISKGTYQVAKWNGTRVSVKIFDKDSYSDPERVNAFTNEL
TLLAKARHPNIVQFVGAVTQNLPMMIVVECNPKGDLSVYLQKKGRLSPSKALRFALDIAR
GMNYLHECKPDPIIHCELMPKNILLDRGGQLKISGFGLIKLSKIGEDSAKVVNHEAQIDK
SNYYIAPEIYKDEVFDKRADVHSFGVILYELTEGVSLFHPKPPEEVAESICIEGKRPTIR
TKSKSYPPELKELIEECWHPEISVRPIFSEIIIRLDKIVTNCSKQGWWKDTFKFPWK

www.000webhost.com

Other information
Ka divergence:0.35522KaKs divergence:0.425837
GC content 1 (%):43GC content 2 (%):41GC content divergence:-0.024
Length 1 (bp):1440Length 2 (bp):1434Length divergence:-0.002
MFE 1 (kcal):-419MFE 2 (kcal):-401.9MFE divergence-0.021