Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G43860-AT2G43870
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Pectin lyase-like superfamily protein
Function (paralog2):Pectin lyase-like superfamily protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:0.10253854670985
Log2 mRNA fold difference:-0.35971838300264
Log2 TE fold difference:0.50060686522485
Sequences
Protein sequence

MVYNTSCLILPLALIILDFTLISSLAHPIPSTLNVLSYGAKPDGSKDSTKAFLAAWDVAC
ASANPTTIIVPKGRFLVGNLVFHGNECKQAPISIRIAGSIVAPEDFRIIASSKHWIWFED
VTDVSIYGGILDAQGTSLWKCKNNGGHNCPTGAKSLVFSGSNNIKISGLTSINSQKFHIV
IDNSNNVNIDGVKVSADENSPNTDGIHVESSHSVHITNSRIGTGDDCISIGPGSTNVFIQ
TIRCGPGHGISIGSLGRAEEEQGVDNVTVSNVDFMGTNNGVRIKTWGKDSNSFARNIVFQ
HINMKMVKNPIIIDQHYCLHKPCPKQESGVKVSNVRYEDIHGTSNTEVAVLLDCSKEKPC
TGIVMDDVNLVSVHRPAQASCDNANGSANDVVPFTPCLKREIIIT

MASLLVLFVFFFISSCSAQSYNVLSFGAKPDGKTDATKAFMAVWQTACASSRPVTIVVPK
GRFLLRSVTFDGSKCKPKPVTFRIDGTLVAPADYRVIGNEDYWIFFQHLDGITVYGGVLD
ARGASLWDCKKSGKNCPSGATTIGFQSSSNVVVSGLTSLNSQMFHVVINGCNNVKLQGVK
VLAAGNSPNTDGIHVQSSSSVSIFNTKISTGDDCVSIGPGTNGLWIENVACGPGHGISIG
SLGKDSVESGVQNVTVKTVTFTGTDNGVRIKSWARPSSGFAKNIRFQHCVMNNVENPIII
DQNYCPDHDCPRQVSGIKISDVLFVDIHGTSATEVGVKLDCSSKKPCTGIRLEDVKLTYQ
NKPAASACTHAGGIEAGFFQPNCL

www.000webhost.com

Other information
Ka divergence:-0.212079KaKs divergence:-0.192639
GC content 1 (%):42GC content 2 (%):46GC content divergence:0.045
Length 1 (bp):1218Length 2 (bp):1155Length divergence:-0.027
MFE 1 (kcal):-341.8MFE 2 (kcal):-348.49MFE divergence0.01