Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G44040-AT3G59890
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Dihydrodipicolinate reductase, bacterial/plant
Function (paralog2):Dihydrodipicolinate reductase, bacterial/plant

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-2.1520172319003
Log2 mRNA fold difference:0.045608542485069
Log2 TE fold difference:-1.7742051986785
Sequences
Protein sequence

MATNGLMASSSVFLHRPRIAFASRTNQTVGKYGKGRVSFMGIGTRRLPVVLSMTAMADSG
EEAVKSVLPGNGISIMVNGCSGKMGKAVIKAADSAGVNIVPISFGSAGEDGQRVEVCGKE
ITVHGPTEREKVLSSVFEKHPELIVVDYTIPSAVNDNAELYSKVGVPFVMGTTGGDRNKL
YETVEEAKIYAVISPQMGKQVVAFLAAMEIMAEQFPGAFSGYSLDVMESHQASKLDASGT
AKAVISCFQELGVSYDMDQIQLIRDPKQQVEMVGVPEEHISGHAFHLYHLTSPDETVSFE
FQHNVCGRSIYAEGTVDAVLFLAKKIRLKADQRIYNMIDVLREGNMR

MAANGLMAASSVFLHRPVHPHFSFSSRTNQMVPLGFKGRVSFIGNVKRCFPVVLSMGKSE
TFEEAGNSVAPGNGISIMVNGCSGKMGKAVIKAADSAGVNIVPTSFGSVEEAGQTVEVCG
KEILVHGPTEREKVLSSVFEKYPELIVVDYTIPSAVNDNAELYGKVGVPFVMGTTGGDRT
RLYKTVEESKIYAVISPQMGKQVVAFLAAMEIMSEQFPGAFAGYSLEVMESHQASKLDAS
GTAKAVISCFQKLGVSYDMDQIQLIRDPKQQIEVVGVPEEHVSGHAFHLYHLTSPDKTVS
FEFQHNVCGRSIYAEGTVDAVLFLAKKIRSKAEKRIYNMIDVLREGNMR

Other information
Ka divergence:-0.0492592KaKs divergence:-0.249465
GC content 1 (%):46GC content 2 (%):44GC content divergence:-0.022
Length 1 (bp):1044Length 2 (bp):1050Length divergence:0.003
MFE 1 (kcal):-350.86MFE 2 (kcal):-337.9MFE divergence-0.019