Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G44090-AT3G59910
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Ankyrin repeat family protein
Function (paralog2):Ankyrin repeat family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.42693809223726
Log2 mRNA fold difference:0.06128941920944
Log2 TE fold difference:-0.48110476447803
Sequences
Protein sequence

MENDDMYPDEPVGSDLEPQESDVVFARESPLVGIITQPTKCSGSTAKILKCRGLEQQKKL
NRQDRIELGRLFQGAVSSQDWQLSERFIQLADPQTLNDLLCISLDSIWFLSTEHELRGIT
ELIAKIICHGAQDYTRATLRTSFLASCVSSCHSRTVSLADTVTVMAQRLHERLQECNGDE
VLKAEAGAKVQKFTEWALKCIGFHSRCQGPRDKANQDSAAEIQLQLSAFKMFLDLAGNHL
SGKDFTEAFDAACFPLTLFSTSFNPGWASGISATVIHGLLGMLVEGGADNVNQCFLEASR
FGSTELVRILLQIAQRNSLDVDVDLALGFASHYSKIETMDCLVEEGHAIAFLGPLMRAAE
RGCMQVVQWFVKRGCREMELCLALTAATSSSQVEVAAYLLPHVPRPVLTALSIEILKAAG
ERSGGSLHGVEFLLKSDFLGDPAATYSVADTIAKSEDESVPSDLKSFLQEQWSEAAFNQG
LKESRENYMNFMRVLKLGESAISLKDLPAPLRVAIAYMPLYRECVDAGGRLLSQKLRGQL
VEAATQLEGFDVDTEEVKKGHHQLMTILEHHLPLFLVKASLH

MEKEGVCDTINLSDQMYPDEPFCSEMKTETIASSQKFEGGEGSKVVFSREAPLIGKDSAG
TNSGECCGCSAKKLNFKGDDDLVEKENIEQQKKLNRQERIELGRLFQGAVTSLDWELAER
LIQLADPQTLNDLLCVGLDSVWFLSTKPEFQGITGLIKKIICHGAHDFTRATLRTSFLAS
CVSACQSRTMSLSDTVTVMAQRLHERLQECNGDEILKAEAGAKVQKFTEWALKCIGFHSR
CQGAKDRVSQNSAAEIELQLSAFKMFLDLAGNHLSGRDFTEAFDAACFPLTLFSNSFDPG
WASGMSATVIQGLLGMLVEGGADNVNQCFLEASRFGSTELVRVLLQIAQRNSLDVDVDLA
LGFASHYCKIGTMKCLVEEGNAIAFLGPLMRAAERGCMQVVQWFVKRGCRDMELCLALTA
ATSSCQVEVAAYLLPRVPPPVLTALSIEILKAAGERSGGSLQGVEFLLKSDFLGDSTATY
SVADSIARSSEDESVPSDLKSFLQEHWSESAFEKGMRESHDDFMNFMRVLKKGESAISLR
DLPAPLRVAIAYMPLYRECMKADGRLLSQRLRGQLVEAVRQLQGCAVAVVEVSQTRNLMA
VLEHHLTAIFD

Other information
Ka divergence:-0.0130891KaKs divergence:0.137721
GC content 1 (%):45GC content 2 (%):45GC content divergence:0
Length 1 (bp):1749Length 2 (bp):1836Length divergence:0.024
MFE 1 (kcal):-571.15MFE 2 (kcal):-596.8MFE divergence0.022