Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G44100-AT3G59920
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):guanosine nucleotide diphosphate dissociation inhibitor 1
Function (paralog2):RAB GDP dissociation inhibitor 2

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.97355561986785
Log2 mRNA fold difference:1.295057382838
Log2 TE fold difference:-0.31519262457958
Sequences
Protein sequence

MDEEYEVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLNQLWKKFRGEEK
APAHLGSSRDYNVDMMPKFMMANGKLVRVLIHTDVTKYLSFKAVDGSYVFVQGKVQKVPA
TPMEALKSPLMGIFEKRRAGKFFSYVQEYDEKDPKTHDGMDLRRVTTKDLIAKFGLKEDT
IDFIGHAVALHCNDNHLHQPAYDTVMRMKLYAESLARFQGGSPYIYPLYGLGELPQAFAR
LSAVYGGTYMLNKPECKVEFDEEGKVSGVTSEGETAKCKKVVCDPSYLTNKVRKIGRVAR
AIAIMSHPIPNTNDSQSVQVILPQKQLGRKSDMYVFCCSYSHNVAPKGKFIAFVSTDAET
DNPQTELQPGIDLLGPVDELFFDIYDRYEPVNEPTLDNCFISTSYDATTHFDTTVVDVLN
MYKLITGKELDLSVDLNAASAAEEE

MDEEYEVIVLGTGLKECILSGLLSVDGVKVLHMDRNDYYGGESTSLNLNQLWKKFRGEEK
APEHLGASRDYNVDMMPKFMMGNGKLVRTLIHTDVTKYLSFKAVDGSYVFVKGKVQKVPA
TPMEALKSSLMGIFEKRRAGKFFSFVQEYDEKDPKTHDGMDLTRVTTKELIAKYGLDGNT
IDFIGHAVALHTNDQHLDQPAFDTVMRMKLYAESLARFQGTSPYIYPLYGLGELPQAFAR
LSAVYGGTYMLNKPECKVEFDEGGKVIGVTSEGETAKCKKIVCDPSYLPNKVRKIGRVAR
AIAIMSHPIPNTNDSHSVQVIIPQKQLARKSDMYVFCCSYSHNVAPKGKFIAFVSTDAET
DNPQTELKPGTDLLGPVDEIFFDMYDRYEPVNEPELDNCFISTSYDATTHFETTVADVLN
MYTLITGKQLDLSVDLSAASAAEE

Other information
Ka divergence:0.174479KaKs divergence:0.278351
GC content 1 (%):44GC content 2 (%):45GC content divergence:0.011
Length 1 (bp):1338Length 2 (bp):1335Length divergence:-0.001
MFE 1 (kcal):-404.1MFE 2 (kcal):-402.96MFE divergence-0.001