Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G44130-AT3G59940
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Galactose oxidase/kelch repeat superfamily protein
Function (paralog2):Galactose oxidase/kelch repeat superfamily protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.67977509451109
Log2 mRNA fold difference:0.86940009182833
Log2 TE fold difference:-0.012384978199495
Sequences
Protein sequence

MTMEVSKKKGGDFQQCHELIPGLPSELALECLVRVPFQFQSAMRSVCRSWRSLLSDSSFI
QERRRCGKTELLLCLVQPLTPPIPASKSVDETLMVDEKKSEDESHPRVFCTPRFGLSVYN
AAMSTWHRVAFPEEEQIPLFCECVVLQDAGKILLIGGWDPETLQPTRDVYVLEFAGRKWR
RGAPMKESRSFFACASVSPTKVYVAGGHDDQKNALRSAEVYDVEKDEWSSVTPMTEGRDE
CQGFAVGMGLRFCVLSGYGTESQGRFRSDGEIYDPATDSWSRIDNVWRFPDTSPRGRTAG
DFRSSSTLWCFTDTDLQSERRWETNDDSRNLKLDLQSIQLPMTGSSVFAGSLGGESVVMI
GGKRESEGEGEGGVMMKMTTEKKMGKWSHHVHIPCDFSTLPFSHASIYV

MGVSKKKSGEIRGDLIPGLPEELAIECLVRVPFQFHSSIKSVCRSWKCVISSRSFIKERI
GFGKAESLLCLVQPLTSPPSPAMMEGGEMSQKKKEEEEGESQMTQQLLQPRITGTPLYGL
SVYNATLDTWHRVAIPERIPLFCECVAIQDAGKVLLIGGWDPETLQPVRDVFVLDFFAGE
GSGRRFRRGRPMSAARSFFACASVGSTKVYVAGGHDDQKNALRSAEVYDVEKDEWSMLPP
MTEGRDECHGFSMATDPGFCVLSGYGTETQGQFRSDGEIYDPITNSWSTIENVWPFPDLS
PRGRTAAAAAEFPGDFRGCRLWCFIDSERQSQPHWEVEDDSMKWKVIMDTIRLPVTTMTS
VFAGSLSGQAVAMIGGGGEESGTMMVKTTAEKNGGKWSHVNTPSGFSSLPFSCSSIYV

Other information
Ka divergence:-0.200948KaKs divergence:0.478554
GC content 1 (%):49GC content 2 (%):49GC content divergence:0
Length 1 (bp):1230Length 2 (bp):1257Length divergence:0.011
MFE 1 (kcal):-437.2MFE 2 (kcal):-443.7MFE divergence0.007