Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G44140-AT3G59950
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Peptidase family C54 protein
Function (paralog2):Peptidase family C54 protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.066789663081142
Log2 mRNA fold difference:-0.23630365208978
Log2 TE fold difference:0.18608707933623
Sequences
Protein sequence

MKALCDRFVPQQCSSSSKSDTHDKSPLVSDSGPSDNKSKFTLWSNVFTSSSSVSQPYRES
STSGHKQVCTTRNGWTAFVKRVSMASGAIRRFQERVLGPNRTGLPSTTSDVWLLGVCYKI
SADENSGETDTGTVLAALQLDFSSKILMTYRKGFEPFRDTTYTSDVNWGCMIRSSQMLFA
QALLFHRLGRAWTKKSELPEQEYLETLEPFGDSEPSAFSIHNLIIAGASYGLAAGSWVGP
YAICRAWESLACKKRKQTDSKNQTLPMAVHIVSGSEDGERGGAPILCIEDATKSCLEFSK
GQSEWTPIILLVPLVLGLDSVNPRYIPSLVATFTFPQSVGILGGKPGASTYIVGVQEDKG
FYLDPHEVQQVVTVNKETPDVDTSSYHCNVLRYVPLESLDPSLALGFYCRDKDDFDDFCL
RALKLAEESNGAPLFTVTQTHTAINQSNYGFADDDSEDEREDDWQML

MKAICDRFVPSKCSSSSTSEKRDISSPTSLVSDSASSDNKSNLTLCSDVVASSSPVSQLC
REASTSGHNPVCTTHSSWTVILKTASMASGAIRRFQDRVLGPSRTGISSSTSEIWLLGVC
YKISEGESSEEADAGRVLAAFRQDFSSLILMTYRRGFEPIGDTTYTSDVNWGCMLRSGQM
LFAQALLFQRLGRSWRKKDSEPADEKYLEILELFGDTEASAFSIHNLILAGESYGLAAGS
WVGPYAVCRSWESLARKNKEETDDKHKSFSMAVHIVSGSEDGERGGAPILCIEDVTKTCL
EFSEGETEWPPILLLVPLVLGLDRVNPRYIPSLIATFTFPQSLGILGGKPGASTYIVGVQ
EDKGFYLDPHDVQQVVTVKKENQDVDTSSYHCNTLRYVPLESLDPSLALGFYCQHKDDFD
DFCIRATKLAGDSNGAPLFTVTQSHRRNDCGIAETSSSTETSTEISGEEHEDDWQLL

www.000webhost.com

Other information
Ka divergence:-0.00728074KaKs divergence:-0.023836
GC content 1 (%):45GC content 2 (%):44GC content divergence:-0.011
Length 1 (bp):1404Length 2 (bp):1434Length divergence:0.011
MFE 1 (kcal):-429.6MFE 2 (kcal):-441.13MFE divergence0.013