Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G44160-AT3G59970
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):methylenetetrahydrofolate reductase 2
Function (paralog2):methylenetetrahydrofolate reductase 1

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.50025604451951
Log2 mRNA fold difference:1.1796109578294
Log2 TE fold difference:-0.47216575370799
Sequences
Protein sequence

MKVIDKIQSLADEGKTAFSFEFFPPKTEDGVDNLFERMDRMVAYGPTFCDITWGAGGSTA
DLTLDIASRMQNVVCVESMMHLTCTNMPVEKIDHALETIRSNGIQNVLALRGDPPHGQDK
FVQVEGGFDCALDLVNHIRSKYGDYFGITVAGYPEAHPDVIGENGLASNEAYQSDLEYLK
KKIDAGADLIVTQLFYDTDIFLKFVNDCRQIGISCPIVPGIMPINNYRGFLRMTGFCKTK
IPVEVMAALEPIKDNEEAVKAYGIHLGTEMCKKMLAHGVKSLHLYTLNMEKSALAILMNL
GMIDESKISRSLPWRRPANVFRTKEDVRPIFWANRPKSYISRTKGWEDFPQGRWGDSRSA
SYGALSDHQFSRPRARDKKLQQEWVVPLKSVEDIQEKFKELCLGNLKSSPWSELDGLQPE
TRIINEQLIKVNSKGFLTINSQPSVNAERSDSPTVGWGGPVGYVYQKAYLEFFCSKEKLD
AVVEKCKALPSITYMAVNKGEQWVSNTAQADVNAVTWGVFPAKEIIQPTIVDPASFNVWK
DEAFETWSRSWANLYPEADPSRNLLEEVKNSYYLVSLVENDYINGDIFAVFADL

MKVVDKIKSVTEQGQTAFSFEFFPPKTEDGVENLFERMDRLVSYGPTFCDITWGAGGSTA
DLTLEIASRMQNVICVETMMHLTCTNMPIEKIDHALETIRSNGIQNVLALRGDPPHGQDK
FVQVEGGFACALDLVNHIRSKYGDYFGITVAGYPEAHPDVIEADGLATPESYQSDLAYLK
KKVDAGADLIVTQLFYDTDIFLKFVNDCRQIGINCPIVPGIMPISNYKGFLRMAGFCKTK
IPAELTAALEPIKDNDEAVKAYGIHFATEMCKKILAHGITSLHLYTLNVDKSAIGILMNL
GLIDESKISRSLPWRRPANVFRTKEDVRPIFWANRPKSYISRTKGWNDFPHGRWGDSHSA
AYSTLSDYQFARPKGRDKKLQQEWVVPLKSIEDVQEKFKELCIGNLKSSPWSELDGLQPE
TKIINEQLGKINSNGFLTINSQPSVNAAKSDSPAIGWGGPGGYVYQKAYLEFFCSKDKLD
TLVEKSKAFPSITYMAVNKSENWVSNTGESDVNAVTWGVFPAKEVIQPTIVDPASFKVWK
DEAFEIWSRSWANLYPEDDPSRKLLEEVKNSYYLVSLVDNNYINGDIFSVFA

Other information
Ka divergence:0.0165181KaKs divergence:0.3
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):1785Length 2 (bp):1779Length divergence:-0.002
MFE 1 (kcal):-557.56MFE 2 (kcal):-540.2MFE divergence-0.016