Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G44180-AT3G59990
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):methionine aminopeptidase 2A
Function (paralog2):methionine aminopeptidase 2B

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.4190534080976
Log2 mRNA fold difference:0.85624388339534
Log2 TE fold difference:0.54276719944164
Sequences
Protein sequence

MAIGNPEVATMGKENTEAESSNGNESQLSSDLTKSLDLAEVKEDEKDNNQEEEDGLKAEA
STKKKKKKSKSKKKKSSLQQTDPPSIPVLELFPSGDFPQGEIQQYNDDNLWRTTSEEKRE
MERLQKPIYNSLRQAAEVHRQVRKYMRSILKPGMLMIDLCETLENTVRKLISENGLQAGI
AFPTGCSLNNVAAHWTPNSGDKTVLQYDDVMKLDFGTHIDGHIVDSAFTVAFNPMFDPLL
AASRDATYTGIKEAGVDVRLCDVGAAVQEVMESYEVEINGKVYQVKSIRNLNGHSIGRYQ
IHAEKSVPNVRGGEQTKMEEGELYAIETFGSTGKGYVREDLECSHYMKNYDVGHVPLRLP
RAKQLLATINKNFSTLAFCRRYLDRLGETKYLMALKNLCDSGIIEPCPPVCDVKGSYISQ
FEHTILLRPTCKEIISKGDDY

MASESPDVAVVAPVVENGGAESSNGKEEQLESELSKKLEIAEDGQEENDGEEGSKAETST
KKKKKKNKSKKKKELPQQTDPPSIPVVELFPSGEFPEGEIQEYKDDNLWRTTSEEKRELE
RFEKPIYNSVRRAAEVHRQVRKYVRSIVKPGMLMTDICETLENTVRKLISENGLQAGIAF
PTGCSLNWVAAHWTPNSGDKTVLQYDDVMKLDFGTHIDGHIIDCAFTVAFNPMFDPLLAA
SREATYTGIKEAGIDVRLCDIGAAIQEVMESYEVEINGKVFQVKSIRNLNGHSIGPYQIH
AGKSVPIVKGGEQTKMEEGEFYAIETFGSTGKGYVREDLECSHYMKNFDAGHVPLRLPRA
KQLLATINKNFSTLAFCRRYLDRIGETKYLMALKNLCDSGIVQPYPPLCDVKGSYVSQFE
HTILLRPTCKEVLSKGDDY

www.000webhost.com

Other information
Ka divergence:-0.307313KaKs divergence:0.140752
GC content 1 (%):41GC content 2 (%):44GC content divergence:0.035
Length 1 (bp):1326Length 2 (bp):1320Length divergence:-0.002
MFE 1 (kcal):-389.3MFE 2 (kcal):-396.4MFE divergence0.009