Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G44230-AT2G44260
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Plant protein of unknown function (DUF946)
Function (paralog2):Plant protein of unknown function (DUF946)

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-1.2984149877828
Log2 mRNA fold difference:-1.505161929486
Log2 TE fold difference:0.36914955581279
Sequences
Protein sequence

MGNNSSAQSSTPSLPIDSTFNLPSPLPSWPSGEGFAKGRIDLGGLEVSQVDTFNKVWTVY
EGGQDNLGATFFEPSSVPEGFSILGFYAQPNNRKLFGWTLVGKDLSGDSLRPPVDYLLLW
SGKSTKVENNKVETGYFWQPVPPDGYNAVGLIVTTSDEKPPLDKIRCVRSDLTDQSEPDA
LIWETNGFSVSSSKPVNRGTQASGVSVGTFFSNSPNPALPCLKNNNFDFSCMPSKPQIDA
LFQTYAPWIYFHKDEKYLPSSVNWFFSNGALLYKKGDESNPVPVEPNGLNLPQGEFNDGL
YWLDLPVASDARKRVQCGDLQSMEVYLHIKPVFGGTFTDIAVWMFYPFNGPSRAKLKAAS
IPLGRIGEHIGDWEHFTLRISNFSGKLHRMYLSQHSGGSWADASEIEFQGGGNKPVAYAS
LNGHAMYSKPGLVLQGKDNVGIRNDTGKSEKVIDTAVRFRVVAAEYMRGELEEPAWLNYM
RHWGPKIDYGHENEIRGVEKIMVGESLKTTFRSAIKGLPNEVFGEEGPTGPKLKRNWLGD
EV

MGNCLSTSDPSHEDVSKKLPKALPVDAAFKFPSPLPTFTRGLYYHRFLLISLSLSVSQLV
LIILISLASSGDGFAKGTIDLGGGLEVSQVSTFNKVWSTYEGGPDNLGATFFEPSSIPSG
FSILGYYAQPNNRNLFGWVLTARDLSSNTLKPPVDYTLVGNTESLKIKQDGTGYFWQPVP
PDGYQAVGLIVTNYSQKPPLDKLRCIRSDLTEQCEADTWIWGTNGVNISNLKPTTRGTQA
TGVYVGTFTWQTQNSSPPSLSCLKNTKLDFSTMPNGSQIEELFQTFSPCIYFHPDEEYLP
SSVTWYFNNGALLYKKGEESKPIPIESNGSNLPQGGSNDGSYWLDLPIDKNGKERVKKGD
LQSTKVYLHIKPMLGATFTDISIWIFYPFNGPAKAKVKFVNLPLGRIGEHIGDWEHTTLR
ISNFTGELWRVFLSQHSGGIWIDACDLEFQDGGNNKFVAYASLHGHAMYPKPGLVLQGDD
GVGIRNDTGKGKKVLDTGLGYEVIAAEYDGGGVVEPPWVKYFRKWGPKIDYNVDDEVKSV
ERILPGLLKKAFVKFVKKIPDEVYGEDGPTGPKLKSNWAGDES

Other information
Ka divergence:-0.142667KaKs divergence:-0.284935
GC content 1 (%):46GC content 2 (%):43GC content divergence:-0.034
Length 1 (bp):1629Length 2 (bp):1752Length divergence:0.036
MFE 1 (kcal):-518.52MFE 2 (kcal):-510.33MFE divergence-0.008