Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G44280-AT3G60070
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Major facilitator superfamily protein
Function (paralog2):Major facilitator superfamily protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:1.0983974542215
Log2 mRNA fold difference:1.4238090130904
Log2 TE fold difference:-0.19397001500853
Sequences
Protein sequence

MTSSVIVGMEEEEEDPSTKPLGRLSVFYYGVGHMLNDITASCWFTYLLLFLTQIGLSPRD
AAIVMLSGQVADGFATIFIGELIDRFGHFKIWHAAGSLLVAISFSSVFGGCLPCSLLHNN
SSTIETLSYSMFAAIFNIGWAATQVSHMAMVNCITLNSTSRVALTSSRNAFSMVANLGLY
AIALVVFGVSEAVTKENTESQYRWIAYSSITVGCCFVVIFLMGTKEPRLRINLRETSRAR
IPWSYWFRKILYYQVAMVYLLTRLVLNVSQAYLAFFVIDDLQMAQSAKALIPAIIYVCSF
VVSVMLQEIPWNGKRLKAYYCAGGIIWIFCGISILLLPRSINSYMYAISVFIGIANAVML
VTSISMQSVLIGSKLGGCAFVCGSLSFLDKMSCGLALYVLQSHQGTSPKVDVNIKEYFYF
SVTRYGLGLVPAVCSLVGVVVTYFMELDSTILKPLCQPLLLE

MTGGSEEDPFTKPIGRWSVFFYGVGHMLNDITASCWFTYLLLFLTQIGLSPRDAAIVMLS
GQVADAFATIFTGELIDRFGHFKIWHAAGSLLVAISFSSVFGGCLPCSILHNDSLTLETF
SYSMFAAIFNIGWAATQVSHMAMVNCISLNSTSRVALTSSRNAFTMVANLGLYAIALVVF
GVIKAGSKEDTETQYRWIAYSSITIGCCFVVIFLMGTKEPRLRIDLKETSRARIPWVYWF
RKILYYQVAMVYLLTRLVLNVSQAYLAFFVIDDLQMDQSAKALVPAIIYICSFVVSVLLQ
EIPWNGKRLKAYYTAGGIIWIFCGAAILLLPRDISSFMYAISVFIGIANALMMVTAISMQ
SVLVGAEVGGCAFVCGSLSFLDKMSCGLALYVLQSHQTTSPRGQLNNNQQSVYLSVTRYG
LGLVPALCSFVGVAVTFFMELEAAGSLSKPLLREPLLE

Other information
Ka divergence:-0.178044KaKs divergence:-0.0166577
GC content 1 (%):39GC content 2 (%):42GC content divergence:0.037
Length 1 (bp):1389Length 2 (bp):1377Length divergence:-0.004
MFE 1 (kcal):-386.6MFE 2 (kcal):-400.4MFE divergence0.018