Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G44290-AT2G44300
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein
Function (paralog2):Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.7850243073416
Log2 mRNA fold difference:-2.5529766744726
Log2 TE fold difference:0.73497155679384
Sequences
Protein sequence

MESRKIKVMATAIALIMVAMVVDAAGADKGKDKEECTAQLVGMATCLPYVQGKAKSPTPD
CCSGLKQVINSDMKCLCMIIQERNDPDLGLQVNVSLALALPSVCHATADITKCPALLHLD
PNSPDAQVFYQLAKGLNETVSASAPTGSASEPTSMSSTPGSSAGNNSGRTTSVPGTNHAQ
SFSKQWLGLEVVAHFFVIFYIFILV

MESRKINLMATAIALIVVAMVVAAADDKTKDKEECTEQLVGMATCLPYVQGQAKSPTPDC
CSGLKQVLNSNKKCLCVIIQDRNDPDLGLQINVSLALALPSVCHAAADVTKCPALLHLDP
NSPDAQVFYQLAKGLNKTGPASAPTGSSPGPISISPTSGSDDGNNSGRTTSVPGRNHAQS
FYKQWLGLEVVFHFFVIFYIFILV

www.000webhost.com

Other information
Ka divergence:-0.757006KaKs divergence:-0.999879
GC content 1 (%):49GC content 2 (%):48GC content divergence:-0.01
Length 1 (bp):618Length 2 (bp):615Length divergence:-0.002
MFE 1 (kcal):-197.12MFE 2 (kcal):-186.39MFE divergence-0.028