Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G44330-AT3G60080
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):RING/U-box superfamily protein
Function (paralog2):RING/U-box superfamily protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:5.0607423674495
Log2 mRNA fold difference:5.4761376666571
Log2 TE fold difference:-0.72096794901591
Sequences
Protein sequence

MSSSSTQNQLEMRDYTCPECNIGLRVLSLPSASPPYCPLCNVASYFTSSTPFEVGPNPFE
DDEESQFLDPMESLPTIKISSSMLSSASSDDSALPCAICREDFVVGESARRLPCNHLYHN
DCIIPWLTSHNSCPLCRVELPVASSEDDSGLDMWFDALNLEDDLEEEAGVTLDLEQSLDG

MSSSTTTTTTVHGEPERRTYWCHECDMSLSLLSSSDSDSDSSPLLCPQCRVDFLERMDHD
SSSSNLFDVTIGDFEEQDGENDDEDDEEDWCFVDPAVNSDDNFLLDSPYLHRLLRHLASD
NSGSSSSSSSSSSSSLLKSSDIDSIPTIQISSSLLCSTDDSDPDSVLLCAVCKEDFIIGE
SARRLPCSHIYHSDCIVPWLSDHNSCPLCRFELPTTAKVGIGGSEAEMRIRLSDLATIAA
DGDDVEDDWLGIRNALRRLARRHEQMRLGVGEMERNLARTVSGLGIGMRRREEIEADRSN
VTTTPL

Other information
Ka divergence:-0.476949KaKs divergence:-0.665169
GC content 1 (%):46GC content 2 (%):46GC content divergence:0
Length 1 (bp):543Length 2 (bp):921Length divergence:0.258
MFE 1 (kcal):-170.9MFE 2 (kcal):-293.91MFE divergence0.265