Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G44350-AT3G60100
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Citrate synthase family protein
Function (paralog2):citrate synthase 5

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-5.1628655852309
Log2 mRNA fold difference:-6.7251640695515
Log2 TE fold difference:1.5555313199587
Sequences
Protein sequence

MVFFRSVSAFTRLRSRVQGQQSSLSNSVRWIQMQSSTDLDLKSQLQELIPEQQDRLKKLK
SEHGKVQLGNITVDMVIGGMRGMTGLLWETSLLDPEEGIRFRGLSIPECQKVLPTAQSGA
EPLPEGLLWLLLTGKVPSKEQVEALSKDLANRAAVPDYVYNAIDALPSTAHPMTQFASGV
MALQVQSEFQKAYENGIHKSKFWEPTYEDCLNLIARVPVVAAYVYRRMYKNGDSIPSDKS
LDYGANFSHMLGFDDEKVKELMRLYITIHSDHEGGNVSAHTGHLVGSALSDPYLSFAAAL
NGLAGPLHGLANQEVLLWIKSVVEECGEDISKEQLKEYVWKTLNSGKVIPGYGHGVLRNT
DPRYVCQREFALKHLPDDPLFQLVSKLYEVVPPVLTELGKVKNPWPNVDAHSGVLLNHYG
LTEARYYTVLFGVSRSLGICSQLIWDRALGLALERPKSVTMDWLEAHCKKASSA

MVFFRSVSAISRLRSRAVQQSSLSNSVRWLHSSELDLKSQMQEIIPEQQDRLKKLKSEQG
KVPVGNITVDMVLGGMRGMTGLLWETSLLDADEGIRFRGMSIPECQKILPSAESGEEPLP
ESLLWLLLTGKVPTKEQANALSTELAHRAAVPAIDALPSTAHPMTQFASGVMALQVQSEF
QKAYEQGDISKSKYWEPTFEDALNLIARVPVVASYVYRRMYKDGSIIPLDDSLDYGANFS
HMLGFDSPQMKELMRLYVTIHSDHEGGNVSAHAGHLVGSALSDPYLSFAAALNGLAGPLH
GLANQEVLLWIKLVVEECGESISKEQLKDYVWKTLNSGKVVPGYGHGVLRKTDPRYICQR
EFALKHLPDDPLFQLVSKLYEVVPPILTELGKVKNPWPNVDAHSGVLLNYYGLTEARYYT
VLFGVSRSLGICSQLIWDRALGLPLERPKSVNMDWLDNFTRLNR

www.000webhost.com

Other information
Ka divergence:0.114768KaKs divergence:-0.452596
GC content 1 (%):45GC content 2 (%):44GC content divergence:-0.011
Length 1 (bp):1425Length 2 (bp):1395Length divergence:-0.011
MFE 1 (kcal):-460MFE 2 (kcal):-433.3MFE divergence-0.03