Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G44370-AT2G44380
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Cysteine/Histidine-rich C1 domain family protein
Function (paralog2):Cysteine/Histidine-rich C1 domain family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:1.8981330279879
Log2 mRNA fold difference:1.2647209616824
Log2 TE fold difference:0.6586325122833
Sequences
Protein sequence

MAARKPSVRHPSHNHPLRSHKAQVEEEIICSGCDLDLIGAAFKCTKSECDYFLHKSCFEL
PRETRHKAHPDHPLILLYSPPYESTYTCDACGEYGSGFTYNCSICQYDVHVGCVSMPESV
EREGHAHPLTLLYRSPYQNGLIFNCDVCQETVPDNLWSYYCKECDYGTHLHSCAVEEEEA
EEEEPKRGGGSARGNTKSGGNKGGRGSAASELAAMLEAQREMEKMQIELHMEMQRAKIAK
KARKACLKLI

MASRKPVNRPSVRHASHNHPLRVFKARDEDEVVCSGCELELTGQAFKCMKSDCDYFLHKS
CFDLPRETNHKSHPNHSLTLLHSPPYGQSYTCDACGEYGSGFTYNCSECQYDVHVGCAFI
PETVEREDHEHPLTLLYNTPCKGREDGAKFICDVCEEKMSENLWVYYCKECDYGTHVHSC
AVYEDHESEKRGGGREEGEASSAVSRMKSLMKAQDEMAALQLEARIRNDTNNAILDLWDS
PKRRYYY

www.000webhost.com

Other information
Ka divergence:-0.146618KaKs divergence:0.365688
GC content 1 (%):47GC content 2 (%):46GC content divergence:-0.011
Length 1 (bp):753Length 2 (bp):744Length divergence:-0.006
MFE 1 (kcal):-231.3MFE 2 (kcal):-224.32MFE divergence-0.015