Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G44430-AT3G60110
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):DNA-binding bromodomain-containing protein
Function (paralog2):DNA-binding bromodomain-containing protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-2.6263046995599
Log2 mRNA fold difference:-2.6233242596592
Log2 TE fold difference:-0.01391934514481
Sequences
Protein sequence

MRKEEEEEAGSYNMNVDDTNNNNNYICTDNDYIEEDEDNSNTKKSQTQAWGTWEELLLAC
AVKRHGFGDWDSVATEVRSRSSLSHLLASANDCRHKYRDLKRRFHEQEKTDVTATVEEEE
EEEERVGNNIPWLEQLRNLRVAELRREVERYDCSILSLQLKVKKLEEEREVGEEKPDLEN
ERKEERSENDGSESEHREKAVSAAEESDRENRSMNESNSTATAGEEERVCGDEPSQTRED
DSGNDKNPDPDPVNKDATAAEEEEGSVSRGSEASHSDELGESGTSESKWKRKRRKQGGAG
EIRSAESKSQPLISLLDLIRSHPRGSLFERRLRSQEAKDYKSMVKQHLDIETIQRKLKQG
SYDSSSLIFYRDLQLLFTNAIVFFPLSSSESMAAHELRAVVSQEMRKETGKAGPRLIKQE
ASGMRSGKADAETSDSSLSRQKSSGPLVVCKKRRSVSAKASPSSSSFSQKDDTKEETLSE
EKDNIATGVRSSRRANKVAAVVANNTKTGKGRNKQKQTESKTNSSNDNSSKQDTGKTEKK
TVSADKKKSVADFLKRLKKNSPQKEAKDQNKSGGNVKKDSKTKPRELRSSSVGKKKAEVE
NTPVKRAPGRPQKKTAEATASASGKRGRDTGSTGKDNKQPKKRIRK

MKEDEEEEAVISNGMNDDDDTNNINNSSTEFDNNRIGDGDDNSNLNQIKQVWGTWEELVL
TCAVKRHAFSDWDSVAKEVQARSRSSLIVSAVNCRLKYQDLKRRFQDSVDVGDENTEAAA
NEEDEVGEISWLEQLRSLHMAELRREVQRCDDSILSLQLKVKKLEEEKDGDDGDNKPDLK
NDETKPVRVNRETTESDRDDNRSMNESNSTASVDKIADHDRLDGDKMVKANENSRNPDPD
PVNKAETPEEEERTVSKRSEMSNSGELDESGTSNCLGKRKGQKYRSGGGGGGVKSAGDKS
QPLIDIIKLIRSHPRGSVFESRLRSQDTKDYKRLIRQHLDMKTIEKKMEKGSYVSSSLSF
YRDLKLLFTNAIVFFPTSSSESIAAQELRTLVSNEMKKRTGKLGHCVIKSEAESSVSRQK
SSVLSLVPCKKKSSALKKTSPSSSSRQKDEKKSQEVSEEKIVTTTATTSARSSRRTSKEI
AVVAKDTKTGRAKNNIKKQTDTKTESSDDDDDEKEENSKTEKKTVADKKKSVADFLKRIK
KNSPQKGKETTSKNQKKNDGNVKKENDHQKKSDGNVKKENSKVKPRELRSSTGKKKVEVE
NNNSKSSSKRKQTKETAEVATGKRGRESGKDDKQPRKRSRR

Other information
Ka divergence:0.286594KaKs divergence:0.522669
GC content 1 (%):45GC content 2 (%):44GC content divergence:-0.011
Length 1 (bp):1941Length 2 (bp):1926Length divergence:-0.004
MFE 1 (kcal):-575.21MFE 2 (kcal):-555.84MFE divergence-0.017