Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G44450-AT3G60130
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):beta glucosidase 15
Function (paralog2):beta glucosidase 16

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:1.7693551823702
Log2 mRNA fold difference:2.431192838839
Log2 TE fold difference:-0.70197469744816
Sequences
Protein sequence

MRGNYLSLLVVLIVLASNDVLANNNSSTPKLRRSDFPEDFIFGSATSAYQVEGGAHEDGR
GPSIWDTFSEKYPEKIKDGSNGSVADNSYHLYKEDVALLHQIGFNAYRFSISWSRILPRG
NLKGGINQAGIDYYNNLINELLSKGIKPFATMFHWDTPQALEDAYGGFRGAEIVNDFRDY
ADICFKNFGDRVKHWMTLNEPLTVVQQGYVAGVMAPGRCSKFTNPNCTDGNGATEPYIVG
HNLILSHGAAVQVYREKYKASQQGQVGIALNAGWNLPYTESPKDRLAAARAMAFTFDYFM
EPLVTGKYPVDMVNNVKGRLPIFTAQQSKMLKGSYDFIGINYYSSTYAKDVPCSTKDVTM
FSDPCASVTGERDGVPIGPKAASDWLLIYPKGIRDLVLYAKYKFKDPVMYITENGRDEFS
TNKIFLKDGDRIDYYARHLEMVQDAISVGANVKGFFAWSLLDNFEWAMGYTVRFGLVYVD
FKDGCKRYPKKSAEWFRKLLNEKKND

MRGKFLSLLLLITLACIGVSAKKHSTRPRLRRNDFPQDFVFGSATSAYQCEGAAHEDGRG
PSIWDSFSEKFPEKIMDGSNGSIADDSYNLYKEDVNLLHQIGFDAYRFSISWSRILPRGT
LKGGINQAGIEYYNNLINQLISKGVKPFVTLFHWDLPDALENAYGGLLGDEFVNDFRDYA
ELCFQKFGDRVKQWTTLNEPYTMVHEGYITGQKAPGRCSNFYKPDCLGGDAATEPYIVGH
NLLLAHGVAVKVYREKYQATQKGEIGIALNTAWHYPYSDSYADRLAATRATAFTFDYFME
PIVYGRYPIEMVSHVKDGRLPTFTPEESEMLKGSYDFIGVNYYSSLYAKDVPCATENITM
TTDSCVSLVGERNGVPIGPAAGSDWLLIYPKGIRDLLLHAKFRYNDPVLYITENGVDEAN
IGKIFLNDDLRIDYYAHHLKMVSDAISIGVNVKGYFAWSLMDNFEWSEGYTVRFGLVFVD
FEDGRKRYLKKSAKWFRRLLKGAHGGTNEQVAVI

Other information
Ka divergence:0.188402KaKs divergence:0.292605
GC content 1 (%):42GC content 2 (%):43GC content divergence:0.012
Length 1 (bp):1521Length 2 (bp):1545Length divergence:0.008
MFE 1 (kcal):-438.69MFE 2 (kcal):-466.52MFE divergence0.031