Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G44525-AT3G60150
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein of unknown function (DUF498/DUF598)
Function (paralog2):Protein of unknown function (DUF498/DUF598)

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-1.5429182203609
Log2 mRNA fold difference:-2.7653169795248
Log2 TE fold difference:1.3811826849406
Sequences
Protein sequence

MAMRLKSMATLPKLIQSMRKEVPKHSNPVLPSLRRAFSLYDQINLIDNVPEDQLRFQEFN
DTSFTVNGVKYEGSLLCVGNLLMSWSPRKFSEITTDSLSIFQTVRPIPELLIVGCGRDIH
PVTPEVRQFVKSLGMKLETVDSRNAASTYNILNEEGRVVAAALLPYGVTS

MAVRQKAMATLPKLIQSMRNEVTKQPSLVLPSLRRAFSLYDQINLIDNVPEDQLRFQEFD
ETSFTVNGVKYEGSLLCVGNLLMSWSPRYFSDITTDSLSIFQTVRPIPELLIVGCGRYNH
PLNPQVRQFVKSIGMKLETVDSRNAASTYNILNEEGRIVAAALLPYGVTS

Other information
Ka divergence:-0.0211312KaKs divergence:0.00852459
GC content 1 (%):42GC content 2 (%):45GC content divergence:0.034
Length 1 (bp):513Length 2 (bp):513Length divergence:0
MFE 1 (kcal):-142.15MFE 2 (kcal):-153.7MFE divergence0.039