Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G44600-AT3G60200
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:1.8695572785467
Log2 mRNA fold difference:0.79769937537443
Log2 TE fold difference:1.0396871232296
Sequences
Protein sequence

MRCKRHTVDFSSSIGVCASCLRERLFTLAVSTAASENDDNDHRHSRISPPPLLFPRSVSP
YVAPRKSDAGTGTGAGGRDSVASSNNRFFATPQVVVQSSSSEKVFESDRSFKKKKSGLSR
FSSFFRTRSDDYDSRRDSCDASTVFSQPSSATTSRSWFSKVISVRSKKQSTTNTCYIEDL
IASESDHHHHNQNRPRQRYCRGMSPAGDSTTNDESVEESPGRLRRTPVMGTPGRKKTATI
GIGRSVSGMAFCLSPLVRAKPNCSSNWKAKFPPDFGYSGELKSPAKPHLSTAASFCGNRS
KKLVDLGRVDHRR

MRCKRHTVDLSSSNGVCASCLRERLLSLAASAAVSAAVEDNQSKKSNNNNHPPLLIFPRS
VSPYVTRRKSDAGAGGGDPLVSSNRRFITTPQIDLVGYSCKDFESNRSNKSKQGKKVSRF
SNLFRARSEDFDTNPKSNNPRFSSCDASEISSSSSSSRSWISTILSTGRRKKQPTTACYI
EDVIAARRPQRIYCRGMSPVRDTEPEQSAESIEELRRTPATKTPGRRKIAMGIGKSMSGM
AFCLSPLVRASPNCPFKRKMRFPSEFGNSGEVTAVPEKPHISAAASFCANRSKKLVDLGR
VDRRR

www.000webhost.com

Other information
Ka divergence:0.0687005KaKs divergence:-0.199879
GC content 1 (%):46GC content 2 (%):47GC content divergence:0.011
Length 1 (bp):942Length 2 (bp):918Length divergence:-0.013
MFE 1 (kcal):-298.4MFE 2 (kcal):-278.97MFE divergence-0.034