Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G44650-AT3G60210
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):chloroplast chaperonin 10
Function (paralog2):GroES-like family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-2.9309559230151
Log2 mRNA fold difference:-2.1027185243809
Log2 TE fold difference:-0.8273675252469
Sequences
Protein sequence

MASTFVCSLPNPFFAFPVKATTPSTANHTLLGSRRGCLRIKAISTKWEPTKVVPQADRVL
VRLEDLPIKSSGGVLLPKAAVKFERYLTGEIISVGSEVGQQVGPGKRVLFSDVSAYEVDL
GTDARHCFCKESDLLALVE

MASSFITVPKPFLSFPIKTNAPTLPQQTLLGIRRNSFRINAVSTKWEPAKVVPQADRVLV
RLEVLPEKSSGGVLLPKSAVKFERYLTGEVVSVGSEVGEVEPGKKVLFSDMSAYEVDFGT
EDAKHCFCKESDLLAIVQ

www.000webhost.com

Other information
Ka divergence:-0.138088KaKs divergence:-0.999862
GC content 1 (%):45GC content 2 (%):46GC content divergence:0.011
Length 1 (bp):420Length 2 (bp):417Length divergence:-0.004
MFE 1 (kcal):-119.81MFE 2 (kcal):-138.86MFE divergence0.074