Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G44680-AT3G60250
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):casein kinase II beta subunit 4
Function (paralog2):casein kinase II beta chain 3

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.42318764712508
Log2 mRNA fold difference:1.5146464883972
Log2 TE fold difference:-0.84980604981202
Sequences
Protein sequence

MYKDRSGGGIMGGGGSSRSEILGGAIDRKRINDALDKHLKKSSPSTSRVFTSKDKDSVPS
TSTAKSQLHSRSPDVESDTDSEGSDVSGSEGDDTSWISWFCNLRGNEFFCEVDEDYIQDD
FNLCGLSGQVPYYDYALDLILDVESSNGDMFTEEQHEMVESAAEMLYGLIHVRYILTTKG
MAAMMEKYKNYDFGRCPRVFCCGQSCLPVGQSDIPRSSTVKIYCPKCEDIYYPRSKYQGN
IDGAYFGTTFPHLFLMAYGNMKPQKPAQNYVPKIFGFKVHNKQ

MYKERSGGGGGGSSRSEILGGAIDRKRINDALNKKLEKSSTSTTTSRVFSSKDKDPFSFT
STKTQLPDVESETDSEGSDVSGSEGDDTSWISWFCNLRGNDFFCEVDEDYIQDDFNLCGL
SGQVPYYDYALDLILDVDASNSEMFTDEQHEMVESAAEMLYGLIHVRYILTTKGMAAMTE
KYKNCDFGRCPRVFCCGQSCLPVGQSDIPRSSTVKIYCPKCEDISYPRSKFQGNIDGAYF
GTTFPHLFLMTYGNLKPQKPTQSYVPKIFGFKVHKP

Other information
Ka divergence:0.385933KaKs divergence:0.616071
GC content 1 (%):41GC content 2 (%):42GC content divergence:0.012
Length 1 (bp):852Length 2 (bp):831Length divergence:-0.012
MFE 1 (kcal):-238.2MFE 2 (kcal):-251.34MFE divergence0.027