Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G44770-AT3G60260
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):ELMO/CED-12 family protein
Function (paralog2):ELMO/CED-12 family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.0070501473020946
Log2 mRNA fold difference:-1.1317529852895
Log2 TE fold difference:1.0812983316717
Sequences
Protein sequence

MDDREGSFVAVRRISQGLERGSVYNSSSAEAVPGSAAWLGRGLSCVCAQRRDSDANSTFD
LTPAQEECLQSLQNRIDVAYDSTIPLHQEALRELWKLSFPEEELHGLISEQWKEMGWQGK
DPSTDFRGGGFISLENLLYFARNFQKSFQDLLRKQVGDRSVWEYPFAVAGINLTFMLIQM
LDLEAVKPRTIVGATFLKFLSENESAFDLLYCIAFKLMDQQWLSMRASYMEFNTVMKSTR
RQLERELMLEDIMHLEDLPSYALLNQ

MDDRGGSFVAVRRISQGLERGSVYHSSSAEVVAGSAAWLGRGLSCVCVQGRDGDPRPSFD
LTPAQEECLQRLQSRIDVAYDSSIPQHQEALKDLWKLAFPEEELHGIVSDQWKEMGWQGK
DPSTDFRGGGFISLENLLYFARKFPKSFHGLLRKQVGDRSVWEYPFAVAGINITFMLIQM
LDLEAVKPRSIVGETFLRFLSVNESAFDLLYCIAFKLMDQQWLSMRASYMEFNTVMKSTR
RQLEREIMIEDITSLEDLPSYSLLSQ

www.000webhost.com

Other information
Ka divergence:0.070512KaKs divergence:-0.221142
GC content 1 (%):45GC content 2 (%):45GC content divergence:0
Length 1 (bp):801Length 2 (bp):801Length divergence:0
MFE 1 (kcal):-244.42MFE 2 (kcal):-254.11MFE divergence0.019