Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G44790-AT3G60280
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):uclacyanin 2
Function (paralog2):uclacyanin 3

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-2.2681239707673
Log2 mRNA fold difference:-2.2545806797099
Log2 TE fold difference:-0.019286667347554
Sequences
Protein sequence

MAMNGLSKMAVAAATALLLVLTIVPGAVAVTYTIEWTTGVDYSGWATGKTFRVGDILEFK
YGSSHTVDVVDKAGYDGCDASSSTENHSDGDTKIDLKTVGINYFICSTPGHCRTNGGMKL
AVNVVAGSAGPPATPTPPSSTPGTPTTPESPPSGGSPTPTTPTPGAGSTSPPPPPKASGA
SKGVMSYVLVGVSMVLGYGLWM

MGSTVAAALLLFLAAVPAVFAATFKVGDISGWTSNLDYTVWLTGKTFRVGDTLEFVYGLS
HSVSVVDKAGYDNCDSSGATQNFADGDTKIDLTTVGTMHFLCPTFGHCKNGMKLAVPVLA
AAPSPSTPSSPPSTPSTPSSPPSTPSTPSSPPSPPSPPSPSLPPSSLPPSASPPTNGTPD
SETLTPPPAPLPPSLSPNAASKGVMSYGIIGVTMILMYAVMT

www.000webhost.com

Other information
Ka divergence:-0.0423792KaKs divergence:-0.338058
GC content 1 (%):52GC content 2 (%):55GC content divergence:0.028
Length 1 (bp):609Length 2 (bp):669Length divergence:0.047
MFE 1 (kcal):-199.05MFE 2 (kcal):-182.86MFE divergence-0.042