Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G44800-AT3G60290
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein
Function (paralog2):2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.5529503321295
Log2 mRNA fold difference:-5.0770209731229
Log2 TE fold difference:3.6579674456419
Sequences
Protein sequence

MEETKMSLLDDSFTSAMTLTNSGVPQVPDRYVLPPSQRPALGSSLGTSETTLPVIDLSLL
HQPFLRSLAIHEISMACKEFGFFQVINHGIPSSVVNDALDAATQFFDLPVEEKMLLVSAN
VHEPVRYGTSLNHSTDRVHYWRDFIKHYSHPLSKWIDMWPSNPPCYKDKVGKYAEATHLL
HKQLIEAISESLGLEKNYLQEEIEEGSQVMAVNCYPACPEPEMALGMPPHSDFSSLTILL
QSSKGLQIMDCNKNWVCVPYIEGALIVQLGDQVEVMSNGIYKSVIHRVTVNKEVKRLSFA
SLHSLPLHKKISPAPKLVNPNNAPAYGEFSFNDFLNYISSNDFIQERFIDTIKKSSS

MEETNKSVVNDYFTSAMELTESGDPHVPTRYILPPSQRPMLGPSIGTSTINLPVIDLSFL
HDPLLRLCVIHEIELACKGFGFFQVINHGISSAVVKDAQDSATRFFDLPADEKMHLVSDN
FQEPVRYGTSINHSTDRVHYWRDFIKHYSHPLSNWINLWPSNPPCYKEKVGKYAEATHVL
HKQLIEAISESLGLEKNYLQEEIEEGSQVMAVNCYPACPEPEIALGMPPHSDYGSLTILL
QSSEGLQIKDCNNNWVCVPYIEGALIVQLGDQVEVMSNGIYKSVVHRVTVNKDYKRLSFA
SLHSLPMHKKISPATQLVNENKPAAYGEFSFNDFLDYISRNDITQKRFIDTLRKKNL

Other information
Ka divergence:0.11322KaKs divergence:0.504216
GC content 1 (%):43GC content 2 (%):42GC content divergence:-0.012
Length 1 (bp):1074Length 2 (bp):1074Length divergence:0
MFE 1 (kcal):-283.73MFE 2 (kcal):-297.76MFE divergence0.024