Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G44900-AT3G60350
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):ARABIDILLO-1
Function (paralog2):ARABIDILLO-2

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.50441927096687
Log2 mRNA fold difference:0.08359697523391
Log2 TE fold difference:0.34716509270278
Sequences
Protein sequence

MSRRVRRKLEEEKGKDKVVVLPSYPETSISNEEDLVAPELLHGFVDWISLPYDTVLQLFT
CLNYRDRASLASTCKTWRCLGASSCLWTSLDLRPHKFDASMAASLASRCVNLHYLRFRGV
ESADSLIHLKARNLIEVSGDYCKKITDATLSMIVARHEALESLQLGPDFCERITSDAIKA
VAFCCPKLKKLRLSGIRDVTSEAIEALAKHCPQLNDLGFLDCLNIDEEALGKVVSVRYLS
VAGTSNIKWSIASNNWDKLPKLTGLDVSRTDIGPTAVSRFLTSSQSLKVLCALNCHVLEE
DESLISYNRFKGKVLLALFTNVFDGLASIFADNTKKPKDIFAYWRELMKTTKDKTINDFI
HWIEWIISHTLLRTAECNPEGLDDFWLNEGAALLLNLMQSSQEDVQERSATGLATFVVVD
DENASIDCGRAEAVMKDGGIRLLLELAKSWREGLQSEAAKAIANLSVNANIAKSVAEEGG
IKILAGLAKSMNRLVAEEAAGGLWNLSVGEEHKNAIAQAGGVKALVDLIFRWPNGCDGVL
ERAAGALANLAADDKCSMEVAKAGGVHALVMLARNCKYEGVQEQAARALANLAAHGDSNN
NNAAVGQEAGALEALVQLTKSPHEGVRQEAAGALWNLSFDDKNRESISVAGGVEALVALA
QSCSNASTGLQERAAGALWGLSVSEANSVAIGREGGVPPLIALARSEAEDVHETAAGALW
NLAFNPGNALRIVEEGGVPALVHLCSSSVSKMARFMAALALAYMFDGRMDEYALMIGTSS
SESTSKNISLDGARNMALKHIEAFVLSFIDPHIFESPVVSSTPTMLAQVTERARIQEAGH
LRCSGAEIGRFVTMLRNPDSTLKACAAFALLQFTIPGGRHAMHHVSLMQNGGESRFLRSA
AASAKTPREAKIFTKILLRNLEHHQAESSI

MSRRVRQRVEDNGKYKVDSPSYTVIGVEDLAPKVQQYVNWTSLPYDTVFHLFTRLNYRDR
ASLASTCRTWRSLGASSFLWSSLDLRAHKFDLSMAASLATRCVDLQKIRFRGVDSADAII
HLKARSLLEISGDYCRKITDATLSMIAARHEALESLQLGPDFCERITSDAIRVIAFCCPK
LKKLRVSGMRDVSSEAIESLAKHCPQLSDLGFLDCLNINEEALGKVVSLRYLSVAGTSNI
KWKVALENWEKLPKLIGLDVSRTTIDHIAVSRLLKSSQSLKVLCALNCPYLEEDKSYSSN
RFKGKVLLAVFTDTFDELASIFADNSKKPKNIFSYWRDLIRKDKSIDEIMLWIEWIISHT
LLRIAESSNSQGLNDFWLNQGATLLLSLMQSAQEDVQERAATGLATFIVVDDENASIDCG
RAEAVMRDGGIRLLLELAKSWREGLQSEAAKAIANLSVNAKVAKAVAEEGGISVLADLAK
SMNRLVAEEAAGGLWNLSVGEEHKNAIAQAGGVNALVDLIFRWPHGCDGVLERAAGALAN
LAADDKCSMEVARAGGVHALVMLARNCKYEGAQEQAARALANLAAHGDSNGNNAAVGQEA
GALEALVQLTQSPHEGVKQEAAGALWNLAFDDKNRESIAAFGGVEALVALAKSSSNASTG
LQERVAGALWGLSVSEANSIAIGHEGGIPPLIALVRSEAEDVHETAAGALWNLSFNPGNA
LRIVEEGGVVALVQLCSSSVSKMARFMAALALAYMFDGRMDEYAMIGTSLESTSKSVTLN
GARTMALDQIKAFIKTFMEHQIFSTGALSSAPSMLAQVSERARIPEAGHLRCSGSEIGRF
VTMLRNPCLVLRACAAFALLQFTIPESRHAMHHASLMQNAGEARGLRSAAAAASMPREAK
IFMKIVLRNLEHQQAESPEGMKVSYNRI

Other information
Ka divergence:0.268421KaKs divergence:0.236471
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):2793Length 2 (bp):2787Length divergence:-0.001
MFE 1 (kcal):-883.04MFE 2 (kcal):-902.58MFE divergence0.011