Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G44910-AT3G60390
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):homeobox-leucine zipper protein 4
Function (paralog2):homeobox-leucine zipper protein 3

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-0.43481811635678
Log2 mRNA fold difference:2.4892419474164
Log2 TE fold difference:-2.9293448224044
Sequences
Protein sequence

MGERDDGLGLSLSLGNSQQKEPSLRLNLMPLTTSSSSSSFQHMHNQNNNSHPQKIHNISW
THLFQSSGIKRTTAERNSDAGSFLRGFNVNRAQSSVAVVDLEEEAAVVSSPNSAVSSLSG
NKRDLAVARGGDENEAERASCSRGGGSGGSDDEDGGNGDGSRKKLRLSKDQALVLEETFK
EHSTLNPKQKLALAKQLNLRARQVEVWFQNRRARTKLKQTEVDCEYLKRCCDNLTEENRR
LQKEVSELRALKLSPHLYMHMTPPTTLTMCPSCERVSSSAATVTAAPSTTTTPTVVGRPS
PQRLTPWTAISLQQKSGR

MSERDDGLGLSLSLSLGFNQKDPSSRLNPMPLASYASSSHMQHMQQSNYNHPQKIQNTWI
NMFQSSERNSDMRSFLRGIDVNRAPSTVVVDVEDEGAGVSSPNSTVSSVMSGKKSERELM
AAAGAVGGGRVEDNEIERASCSLGGGSDDEDGSGNGDDSSRKKLRLSKEQALVLEETFKE
HSTLNPKQKMALAKQLNLRTRQVEVWFQNRRARTKLKQTEVDCEYLKRCCENLTDENRRL
QKEVSELRALKLSPHLYMHMKPPTTLTMCPSCERVAVTSSSSSVAPPVMNSSSPMGPMSP
WAAMPLRQRPAAGSH

www.000webhost.com

Other information
Ka divergence:-0.160505KaKs divergence:0.0427833
GC content 1 (%):48GC content 2 (%):47GC content divergence:-0.011
Length 1 (bp):957Length 2 (bp):948Length divergence:-0.005
MFE 1 (kcal):-314.46MFE 2 (kcal):-300.8MFE divergence-0.022