Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G44940-AT3G60490
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Integrase-type DNA-binding superfamily protein
Function (paralog2):Integrase-type DNA-binding superfamily protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-2.9596946277215
Log2 mRNA fold difference:-1.4803300603876
Log2 TE fold difference:-1.4386906035195
Sequences
Protein sequence

MARQINIESSVSQVTFISSAIPAVSSSSSITASASLSSSPTTSSSSSSSTNSNFIEEDNS
KRKASRRSLSSLVSVEDDDDQNGGGGKRRKTNGGDKHPTYRGVRMRSWGKWVSEIREPRK
KSRIWLGTYPTAEMAARAHDVAALAIKGTTAYLNFPKLAGELPRPVTNSPKDIQAAASLA
AVNWQDSVNDVSNSEVAEIVEAEPSRAVVAQLFSSDTSTTTTTQSQEYSEASCASTSACT
DKDSEEEKLFDLPDLFTDENEMMIRNDAFCYYSSTWQLCGADAGFRLEEPFFLSE

MGKQINIESSATHHQDNIVSVITATISSSSVVTSSSDSWSTSKRSLVQDNDSGGKRRKSN
VSDDNKNPTSYRGVRMRSWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGN
SGFLNFPELSGLLPRPVSCSPKDIQAAATKAAEATTWHKPVIDKKLADELSHSELLSTAQ
SSTSSSFVFSSDTSETSSTDKESNEETVFDLPDLFTDGLMNPNDAFCLCNGTFTWQLYGE
EDVGFRFEEPFNWQND

www.000webhost.com

Other information
Ka divergence:0.204043KaKs divergence:-0.12671
GC content 1 (%):48GC content 2 (%):47GC content divergence:-0.011
Length 1 (bp):888Length 2 (bp):771Length divergence:-0.071
MFE 1 (kcal):-289.78MFE 2 (kcal):-247.81MFE divergence-0.078