Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G45050-AT3G60530
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):GATA transcription factor 2
Function (paralog2):GATA transcription factor 4

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:0.37796923869909
Log2 mRNA fold difference:-0.0052793752701038
Log2 TE fold difference:0.3680468478633
Sequences
Protein sequence

MDVYGLSSPDLLRIDDLLDFSNEDIFSASSSGGSTAATSSSSFPPPQNPSFHHHHLPSSA
DHHSFLHDICVPSDDAAHLEWLSQFVDDSFADFPANPLGGTMTSVKTETSFPGKPRSKRS
RAPAPFAGTWSPMPLESEHQQLHSAAKFKPKKEQSGGGGGGGGRHQSSSSETTEGGGMRR
CTHCASEKTPQWRTGPLGPKTLCNACGVRFKSGRLVPEYRPASSPTFVLTQHSNSHRKVM
ELRRQKEVMRQPQQVQLHHHHHPF

MDVYGMSSPDLLRIDDLLDFSNDEIFSSSSTVTSSAASSAASSENPFSFPSSTYTSPTLL
TDFTHDLCVPSDDAAHLEWLSRFVDDSFSDFPANPLTMTVRPEISFTGKPRSRRSRAPAP
SVAGTWAPMSESELCHSVAKPKPKKVYNAESVTADGARRCTHCASEKTPQWRTGPLGPKT
LCNACGVRYKSGRLVPEYRPASSPTFVLTQHSNSHRKVMELRRQKEQQESCVRIPPFQPQ

www.000webhost.com

Other information
Ka divergence:-0.0485742KaKs divergence:0.251273
GC content 1 (%):49GC content 2 (%):51GC content divergence:0.02
Length 1 (bp):795Length 2 (bp):723Length divergence:-0.047
MFE 1 (kcal):-265.74MFE 2 (kcal):-207.71MFE divergence-0.123