Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G45070-AT3G60540
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Preprotein translocase Sec, Sec61-beta subunit protein
Function (paralog2):Preprotein translocase Sec, Sec61-beta subunit protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-3.3336733911403
Log2 mRNA fold difference:-2.7156781582251
Log2 TE fold difference:-0.60400741408927
Sequences
Protein sequence

MVGSGAPQRGSAAATASMRRRKPTSGAGGGGASGGAAGSMLQFYTDDAPGLKISPNVVLI
MSIGFIAFVAVLHVMGKLYFVK

MVGGGAPQRGSAAATASMRRRKPAGGSSSAGGGAGTMLQFYTDDAPGLKISPNVVLIMSI
GFIAFVAVLHVMGKLYFVKSK

www.000webhost.com

Other information
Ka divergence:0.151043KaKs divergence:0.387615
GC content 1 (%):53GC content 2 (%):49GC content divergence:-0.039
Length 1 (bp):249Length 2 (bp):246Length divergence:-0.006
MFE 1 (kcal):-87.3MFE 2 (kcal):-88.1MFE divergence0.005