Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G45080-AT3G60550
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):cyclin p3;1
Function (paralog2):cyclin p3;2

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-1.4565496208565
Log2 mRNA fold difference:-1.5969328628406
Log2 TE fold difference:0.068391644823718
Sequences
Protein sequence

MDSLAISPRKLRSDLYSYSYQDDSNTVPLVISVLSSLIERTLARNERISRSYGGFGKTRV
FDCREIPDMTIQSYLERIFRYTKAGPSVYVVAYVYIDRFCQNNQGFRISLTNVHRLLITT
IMIASKYVEDMNYKNSYFAKVGGLETEDLNNLELEFLFLMGFKLHVNVSVFESYCCHLER
EVSIGGGYQIEKALRCAEEIKSRQIVQDPKHHHHHQFSRIML

MAVSNSLTISPRKLRSDLYSYSYQNNSKTPLVISVLSSLIDRTLTRNERISRRALPSSGA
GGKTQIFDCREIPDMTIQSYLGRIFRYTKAGPSVYVVAYVYIDRFCQTNPGFRISLTNVH
RLLITTIMIASKYVEDLNYRNSYFAKVGGLETEDLNKLELEFLFLMGFKLHVNVSVFESY
CCHLEREVSFGGGYQIEKALRCAEEIKSRQMIIQDPKHHHHHHQLARILL

www.000webhost.com

Other information
Ka divergence:0.0263179KaKs divergence:-0.366151
GC content 1 (%):41GC content 2 (%):42GC content divergence:0.012
Length 1 (bp):669Length 2 (bp):693Length divergence:0.018
MFE 1 (kcal):-182.89MFE 2 (kcal):-195.89MFE divergence0.034