Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G45120-AT3G60580
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):C2H2-like zinc finger protein
Function (paralog2):C2H2-like zinc finger protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-1.6352342667153
Log2 mRNA fold difference:-0.30145539775763
Log2 TE fold difference:-1.3382430393776
Sequences
Protein sequence

MERYKCRFCFKSFINGRALGGHMRSHMLTLSAERCVITGEAEEEVEERPSQLCDDDDDTE
SDASSSSGEFDNQKMNRLDDELEFDFAEDDDVESETESSRINPTRRRSKRTRKLGSFDFD
FEKLTTSQPSELVAEPEHHSSASDTTTEEDLAFCLIMLSRDKWKQQKKKKQRVEEDETDH
DSEDYKSSKSRGRFKCETCGKVFKSYQALGGHRASHKKNKACMTKTEQVETEYVLGVKEK
KVHECPICFRVFTSGQALGGHKRSHGSNIGAGRGLSVSQIVQIEEEVSVKQRMIDLNLPA
PNEEDETSLVFDEW

MESYKCRVCFKSFVNGKALGGHMRSHMSNSHEEEQRPSQLSYETESDVSSSDPKFAFTSS
VLLEDGESESESSRNVINLTRKRSKRTRKLDSFVTKKVKTSQLGYKPESDQEPPHSSASD
TTTEEDLAFCLMMLSRDKWKKNKSNKEVVEEIETEEESEGYNKINRATTKGRYKCETCGK
VFKSYQALGGHRASHKKNRVSNNKTEQRSETEYDNVVVVAKRIHECPICLRVFASGQALG
GHKRSHGVGNLSVNQQRRVHRNESVKQRMIDLNLPAPTEEDEVSVVFQ

www.000webhost.com

Other information
Ka divergence:-0.0255265KaKs divergence:-0.329872
GC content 1 (%):43GC content 2 (%):42GC content divergence:-0.012
Length 1 (bp):945Length 2 (bp):867Length divergence:-0.043
MFE 1 (kcal):-272.93MFE 2 (kcal):-246.41MFE divergence-0.051