Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G45140-AT3G60600
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):plant VAP homolog 12
Function (paralog2):vesicle associated protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.024847660377851
Log2 mRNA fold difference:1.2304220676731
Log2 TE fold difference:-1.2654197405075
Sequences
Protein sequence

MSNELLTIDPVDLQFPFELKKQISCSLYLGNKTDNYVAFKVKTTNPKKYCVRPNTGVVHP
RSSSEVLVTMQAQKEAPADLQCKDKFLLQCVVASPGATPKDVTHEMFSKEAGHRVEETKL
RVVYVAPPRPPSPVREGSEEGSSPRASVSDNGNASDFTAAPRFSADRVDAQDNSSEARAL
VTKLTEEKNSAVQLNNRLQQELDQLRRESKRSKSGGIPFMYVLLVGLIGLILGYIMKRT

MSNIDLIGMSNRDLIGMSNSELLTVEPLDLQFPFELKKQISCSLYLTNKTDNNVAFKVKT
TNPKKYCVRPNTGVVLPRSTCEVLVTMQAQKEAPSDMQCKDKFLLQGVIASPGVTAKEVT
PEMFSKEAGHRVEETKLRVTYVAPPRPPSPVHEGSEEGSSPRASVSDNGHGSEFSFERFI
VDNKAGHQENTSEARALITKLTEEKQSAIQLNNRLQRELDQLRRESKKSQSGGIPFMYVL
LVGLIGLILGYIMKRT

Other information
Ka divergence:0.367702KaKs divergence:0.164134
GC content 1 (%):45GC content 2 (%):44GC content divergence:-0.011
Length 1 (bp):720Length 2 (bp):771Length divergence:0.034
MFE 1 (kcal):-222.42MFE 2 (kcal):-243.8MFE divergence0.046